KEGG   Photobacterium profundum: PBPRA3485Help
Entry
PBPRA3485         CDS       T00173                                 

Gene name
S4341
Definition
(GenBank) putative phosphoenolpyruvate carboxykinase
  KO
K01610  phosphoenolpyruvate carboxykinase (ATP) [EC:4.1.1.49]
Organism
ppr  Photobacterium profundum
Pathway
ppr00010  Glycolysis / Gluconeogenesis
ppr00020  Citrate cycle (TCA cycle)
ppr00620  Pyruvate metabolism
ppr01100  Metabolic pathways
ppr01110  Biosynthesis of secondary metabolites
ppr01120  Microbial metabolism in diverse environments
ppr01130  Biosynthesis of antibiotics
ppr01200  Carbon metabolism
Module
ppr_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:ppr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PBPRA3485 (S4341)
   00020 Citrate cycle (TCA cycle)
    PBPRA3485 (S4341)
   00620 Pyruvate metabolism
    PBPRA3485 (S4341)
Enzymes [BR:ppr01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.49  phosphoenolpyruvate carboxykinase (ATP)
     PBPRA3485 (S4341)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPCK_ATP AAA_33 AAA_16
Motif
Other DBs
NCBI-ProteinID: CAG21756
UniProt: Q6LLS2
Position
1:3938620..3940212
Genome map
AA seq 530 aa AA seqDB search
MDLSEYGINNVTDVIRNPSFEVLFEEETKPGLEGYEKGIVTELGAVSVDTGIFTGRSPKD
KFIVKDDTTRDTLWWADQGKNDNKAIDQKVWNELKVLVTKQLSGKRLFVVDGYCGTNPDT
RLCIRVITEVAWQAHFVKNMFIRPTEEELASFKPDFVVMNGAKCTNEKWEEQGLNSENFT
VFNLTEKMQLIGGTWYGGEMKKGMFAMMNYFLPLQGIASMHCSANMGENGDVAVFFGLSG
TGKTTLSTDPKRALIGDDEHGWDDNGVFNFEGGCYAKTINLSKEAEPDIYNAIRRDALLE
NVTVRADGAIDFDDNSKTENTRVSYPIYHIENIVKPVSKGGHANKVIFLSADAFGVLPPV
SKLTPAQTKYHFLSGFTAKLAGTERGITEPTPTFSACFGNAFLTLHPTQYAEVLVKRMEA
AGAEAYLVNTGWNGTGKRISIQDTRAIIDAILNGSIDNAETKEMPIFNLEVPTSLPGVNP
EILDPRDTYTDPLQWESKAQDLATRFINNFEKYTDTTEGAELVAAGPQLD
NT seq 1593 nt NT seq  +upstreamnt  +downstreamnt
gtggatctgtctgaatacggtatcaataatgttacggatgttattcgtaacccatctttc
gaagttctattcgaagaagagactaagccaggcctagaaggatacgagaaaggtatcgtt
actgagcttggtgctgtatctgttgatacgggtatttttacaggtcgttcgcctaaagat
aagttcatcgttaaagatgacactacccgcgataccctatggtgggcagaccaaggcaag
aacgacaacaaagcgattgatcaaaaagtctggaatgagttaaaagtattagtcactaag
caactatctggcaagcgcctgtttgtagtagatggttactgtggcacaaacccggatacc
cgcctatgtatccgtgttattacggaagttgcatggcaagcacacttcgtgaaaaacatg
tttattcgcccaacagaagaagagctagcaagctttaaacctgatttcgtggtaatgaac
ggcgcgaagtgcaccaacgagaagtgggaagagcaaggtctgaactctgaaaacttcaca
gtcttcaacctaacagaaaaaatgcagcttatcggtggtacttggtacggcggtgagatg
aagaaaggtatgttcgcaatgatgaactacttccttccgcttcaaggcatcgcgtctatg
cactgttcagctaatatgggcgaaaacggtgacgtagcagtattctttggcctttctggt
acgggtaaaacaacgttatcaactgaccctaaacgtgcgcttatcggtgatgatgagcac
ggctgggatgacaacggtgtattcaactttgaaggcggttgctacgcaaaaaccattaac
ctttcaaaagaagcagaacctgatatctacaatgccatccgtcgtgatgcattactagaa
aacgtaacagtgcgtgctgacggcgcgattgatttcgacgacaactcgaaaacagaaaat
acccgagtgtcttacccaatctaccacattgaaaacattgttaagccagtctctaaaggt
ggccatgcaaacaaggttatcttcttgtctgctgatgcatttggtgtacttcctccggta
tcaaaattaacgccagcacaaactaaataccacttcctatctggtttcacagcaaaacta
gcaggtactgaacgcggtattacagaaccaacgccaacgttctcagcatgttttggtaat
gcattcctaacactgcaccctacacagtatgcagaagtactggttaaacgtatggaagcg
gctggagcagaagcttaccttgttaacactggttggaacggcacaggcaaacgaatttca
attcaagatactcgcgctatcatcgatgcaatcctaaatggctctattgataatgcagaa
acaaaagagatgccaatctttaatcttgaagtaccgacatcgctaccaggtgttaaccct
gaaattctagacccacgtgatacgtatactgacccgctacagtgggaaagcaaagcacaa
gatctagcgactcgcttcatcaataactttgaaaagtacacagatacaacagaaggtgct
gaactggttgctgctggtccacagctcgattaa

DBGET integrated database retrieval system