KEGG   Photobacterium profundum: PBPRA3497Help
Entry
PBPRA3497         CDS       T00173                                 

Gene name
Z5403
Definition
(GenBank) putative oxygen-independent coproporphyrinogen III oxidase
  KO
K02495  oxygen-independent coproporphyrinogen III oxidase [EC:1.3.98.3]
Organism
ppr  Photobacterium profundum
Pathway
ppr00860  Porphyrin and chlorophyll metabolism
ppr01100  Metabolic pathways
ppr01110  Biosynthesis of secondary metabolites
Module
ppr_M00121  Heme biosynthesis, plants and bacteria, glutamate => heme
Brite
KEGG Orthology (KO) [BR:ppr00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    PBPRA3497 (Z5403)
Enzymes [BR:ppr01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.98  With other, known, physiological acceptors
    1.3.98.3  coproporphyrinogen dehydrogenase
     PBPRA3497 (Z5403)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Radical_SAM HemN_C NAD_binding_1
Motif
Other DBs
NCBI-ProteinID: CAG21768
UniProt: Q6LLR0
Position
1:complement(3954089..3955462)
Genome map
AA seq 457 aa AA seqDB search
MSNEQIIWDQALIEKYNYSGPRYTSYPTALEFHEAFTPAEFDMACAQYPDRKLSLYIHIP
FCHKLCYYCGCNKIITRHQHKADQYLDALEQEIRQRASLLGDRQVSQLHWGGGTPTFLTK
KQASRLMALLRDQFSFDTDAEISIEVDPREIELDMLDHLRGEGFNRLSIGVQDFNKEVQK
LVNREQDEDFIVAMVQRAKELGFRSTNLDLIYGLPKQNRELFAETLQQVLKMKPGRLSVF
NYAHMPSLFAAQRKIKDDQLPSANEKLGILQDTIATLTGAGYQFIGMDHFALPDDELAVA
QRNGVLHRNFQGYATQGDCDLLGMGVSAISMIGDCYAQNQKELKTYYSDVQEKRQALWKG
VSLDADDLLRREVIKALICNFQLDMKDIEQRFNLTFNEYFAEDLGLLKTFINDELVTIDG
QFIHVELKGRLLIRNICMCFDKYLRDRARQQQFSRVI
NT seq 1374 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaatgagcagattatttgggatcaagcactgatagaaaagtataactactcaggt
cctcgttatacttcttatccaaccgctcttgaatttcatgaagcctttactcctgcagaa
tttgatatggcttgtgcgcagtatccagaccgcaagctttcgctttatatccatattccg
ttctgtcataagctttgttattactgtggctgtaataagattattacccgccatcaacat
aaggcagatcaataccttgatgctctagagcaagagattcgtcaacgcgcctctctgtta
ggtgatcgccaagtaagccaattacattggggcggcggaacaccaacgttcttaactaag
aagcaagctagccgtttgatggcactgttacgcgaccagttttcatttgatactgatgct
gaaattagtattgaagtagacccgcgtgaaattgaattggatatgcttgatcacttgcgt
ggcgaaggtttcaaccgtttaagcattggtgttcaagattttaataaagaagtgcaaaag
ctggttaatcgcgagcaagatgaagacttcattgttgccatggtacagcgcgctaaagag
ttaggttttcgttcgacgaatcttgatttgatttatggtttgccaaaacagaaccgtgaa
ctatttgccgagacattacagcaagtactgaagatgaagcctgggcgtttatcggtattt
aattacgcgcacatgccaagtttatttgctgctcaacgtaaaattaaagatgaccagcta
ccatcagcgaatgagaagttaggtattctacaagataccattgccacgttaaccggggct
ggttatcagtttattggtatggatcactttgctttacctgatgatgagttagctgttgct
cagcgtaatggtgttcttcaccgtaatttccaaggttatgcgacacaaggcgattgtgat
ttattaggtatgggtgtttcagcaatctcaatgattggtgactgttacgcgcaaaaccag
aaagagctgaaaacttactactcggatgtacaagaaaagcgccaagcattgtggaaaggg
gtatctcttgatgccgatgatttgttgcgtcgtgaagtgattaaagcgttaatttgtaac
ttccagcttgatatgaaagatattgagcagcgattcaatttaacttttaatgaatacttt
gctgaagatctcggtttgcttaaaacctttatcaatgatgaattggttaccattgatggc
caatttattcatgttgagctgaaaggacgtttactgatccgtaatatttgtatgtgcttt
gataagtacttgcgtgaccgagcacgtcagcagcaattctctcgcgttatctaa

DBGET integrated database retrieval system