KEGG   Photobacterium profundum: PBPRB0362Help
Entry
PBPRB0362         CDS       T00173                                 

Gene name
SF3634
Definition
(GenBank) putative mannitol-1-phosphate 5-dehydrogenase
  KO
K00009  mannitol-1-phosphate 5-dehydrogenase [EC:1.1.1.17]
Organism
ppr  Photobacterium profundum
Pathway
ppr00051  Fructose and mannose metabolism
ppr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ppr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    PBPRB0362 (SF3634)
Enzymes [BR:ppr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.17  mannitol-1-phosphate 5-dehydrogenase
     PBPRB0362 (SF3634)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mannitol_dh_C Mannitol_dh UPF0052 Sacchrp_dh_NADP CDI ApbA
Motif
Other DBs
NCBI-ProteinID: CAG22235
UniProt: Q6LKE5
Position
2:complement(406767..407912)
Genome map
AA seq 381 aa AA seqDB search
MKAVHFGAGNIGRGFIGKLLSDANVAVTFADIDKPLVDQLSHDQSYKVKVVGSQCQVDTV
THVTAVNSASQDVIDRIVHTDLVTTAVGPNVLDIIAKTIATGLAQRFEANNEKSLNIIAC
ENMVRGTTHLKNEVYKHLDEQYHARADALVGFVDSAVDRIVPPSEAANDPLEVTVESFSE
WIVDKQQFKGDIPVIEGMEMTDNLMAFVERKLFTLNTGHIMTAYLGALKGHETVRDAIED
NEIREQVKAAMQESGEVLIKRYGFDREVHNAYIEKILGRFANPYLRDEIDRVGRQPIRKL
GENDRLIKPLLGTIEYGTENKTLLKGIAAAFMYTNESDPQAVELQTSLKEQGLRPTLAHY
TGIDADSKEAKTIETIFLQLS
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcagttcattttggcgcaggtaatatcggtcgtggttttattggtaaattactt
tcagatgcaaatgtagcggttacatttgcagacattgataaaccacttgttgatcaatta
agtcatgatcaatcttataaagtaaaagtggttggcagccaatgccaagtcgacacagtc
acccacgtaaccgccgttaactcagcaagccaagacgttatcgatcgcattgtacacaca
gatttagtgactacggctgttgggcctaacgtgcttgatatcattgcgaaaacaatcgca
acaggtcttgcacagcgttttgaggcaaacaatgaaaaatcattaaacatcattgcttgt
gagaacatggtacgtggtacgacacacctaaaaaatgaagtatataaacaccttgatgag
caatatcacgctcgtgcagacgcgttagttggcttcgttgattctgcagtagaccgtatc
gttccaccttcagaagccgcgaatgacccattagaggttactgttgaaagcttcagcgag
tggatcgttgataagcagcaattcaaaggtgatatcccagtaattgaagggatggaaatg
actgacaatttgatggcattcgttgagcgtaagttatttactcttaacactggtcatatt
atgacagcttacctaggcgcactaaaaggtcatgaaactgtacgtgatgccattgaggat
aatgagattcgcgagcaagttaaagccgcgatgcaagaaagtggtgaagtattaatcaaa
cgttatggttttgaccgtgaagtgcacaatgcctacattgaaaaaatcctaggccgattc
gcaaacccttatttacgagacgaaattgaccgtgttggtcgtcaaccaatccgtaaacta
ggagaaaatgatagattaatcaaaccattactaggtacaattgagtacggaacagaaaac
aaaaccttacttaaaggtattgctgctgcatttatgtacaccaacgaatcagatccacag
gccgtcgagctacaaacctcgttaaaagagcaaggcctgcgcccaacattggcacattac
acaggtatcgacgctgacagcaaggaagcgaagactattgaaactatttttctacaattg
agctga

DBGET integrated database retrieval system