KEGG   Photobacterium profundum: PBPRB0577
Entry
PBPRB0577         CDS       T00173                                 

Definition
(GenBank) hypothetical protein
Organism
ppr  Photobacterium profundum
SSDB
Motif
Pfam: LPD22 GH-E
Other DBs
NCBI-ProteinID: CAG22450
UniProt: Q6LJT0
Position
2:670890..677033
AA seq 2047 aa
MSDFGVWMEENQGNTNINELDTPKEVTDLDNFLQNGEQQQNFQLSTSMKYGREADPERAG
RVFRQQLKTGLPSELIERNLDDIEKQSAEKDFDPVAFRNKSPLLSGWLQKPENAKVSHDD
LENLSTMEWLFRAPVEAYQDGADQVRLGGLRYKQMTSQLNDNELQFIDAYKKRGPRSYGA
DSWIGEAFVGATGQLSQFAPMIEEGLKYGVPAGLTAGTFALAAGQAGPQIALPEEIFTVP
GATALGLSSGFAYGKAKQSFELQTGLAYDEFKDFKDINGHPLDDDVAKGAAFFAGAFNAG
LDFVALDKLIETIPGAKNIMSGGATAVIKQALKNPTVTEGLKRFSTEYGKSVSAQVMIDA
GQELVQMIAGETAKRYQGNFENSDMVAIGDRMVEALDASLKANVVLSAPGHSMTLTGDLL
KSRQAQQNKQIMQQLGNSTQQSKLHARAPEKVRELMATVKENGPVQDVMIPVEQWNTLFQ
SESVDPLSMAAEILGDDGMQYREAAATGSDIMIPLDVYTEKLAGSQYHNMLLDDMRFEPD
QMTAREAAAWDASNQQNIEQQAASIADFITQPDETQFIFDDIVGQLKNTGMEMGTAETNA
IQMQSFFRTLSSRTGIDAKKLWSQYGPKVTREMPEVLKSAGGNFDIAVDPILDRIRANDI
PELSDIQGKTMLETLREKGIQDVGGELSARDVDVKLKPFQKKLISESGVTLDDAAQLMAE
AGYIPADIDSVTQNDLLEAIDREMAGDPVYSQLNENAKALEDRETLLSMSGYLEDLGIDV
SQVSNQDIKQQLSNQIANEGDGVTLNQAERGEIKISQDKKFQITFFKNADLSTLLHESGH
MYFEILQDIDKKGMASESISNDLKTVRDWVGAKDGKDITTEQHEQFARGFEQYLREGKAP
TTELQSAFARFRAWLVTIYRQASKLNVDVSEDVRQVFDRMLATDDQIKAAETQMEYNRLF
EDAESAGMTEAEFNRYQKDATLAREQAQEEVTVKAFNEMQREQKKWWKDAEIDMRDQVMA
EMAENPTYQAVNYLQKGKLLDMDLPEGVEALKLSKNALVEKYGKQFLKLLPRPYIYTKTG
GAHPDQIAVLFGFSSGDEMMQLIVNARPMKDVVNAEVDTRMRQQYGDMMNDGTLPETAMD
AAHNDRRASVLAAELKALSRRVSSRGAPTPAAMMKQAAQTVVDRKTVRSLKPSVYLNAER
KAAKQALEAVLAGDYAAAADAKQRQLLNFYMGNYTKKAKAETDKSRDYLNSFNRPKKRQA
LGKAGHDYLDQIDALLEKTEFKRVSLISLDRRKSLSEFIQNQEEQGWTVEIPESLVKQTQ
SRNWKDMTVEELTGLRDAVKNIDYLARFKNKLLRQDEKRKFEEIVDAAVSSIEANNVVHE
IKPNFAETWKDRVKENVSGFMASHTKMEFFFEWLDGDSANGEAWRSFYKPINDADNKEKL
MQESYTKRLAGILDAYTSKERGKWYTDTSHIQHVGRVNKAMAMSVALNWGNVGNQQAVLD
GYTRNDGKNWTETEAQRILEMLDQKDWDTIQKVWDLINDLWPEISKLQKDLTGVSPEKVE
ASLIQTKYGEIKGGYYPLVYDQKLSYAVFKRDEKAATQDLFESNFSKPATKKGHTIERTG
SGGQAVKLDLSVISEHIDNVIHDITHRRALMDTDRLIQNPRVRAAIEKTAGRQMYRQLRP
WLQSIAREQQPTFNYVETLIGKARTGATVVNMGLKVTTAIAQPLGVLNSVDELGVISMMK
GIKDFYANSPVGMKKRLDFVTSRSAMMRNRQKTFDRDIKDAAKRLGKDKKFDKVRESFFY
LTGLLDMGVSVPTWLAAYRKALDGNVDGITAGDENTAIDFADRTVRVTQSEGGAKDLAKI
QRGGEVFRSFTMFYSYFSVLHNQLRKRGRQYVRGDTNTSQLAASMFFLWFAPAVLGELVA
GRGPGDDEDWDKWALKEISSYPFQTVVFVRDLVNGLGDFGYSASPAFDAFEMSVKAVKLP
YKAIAPDEEVKRSDVKAAVLAAGYWGQLPSRQAWITGEYVYDMMTGEEKPEDGFEMMRNL
MLTRPRD
NT seq 6144 nt   +upstreamnt  +downstreamnt
atgtctgactttggtgtttggatggaagaaaaccaaggaaatacaaatatcaatgaattg
gatacgccaaaggaagtgaccgaccttgataatttcttgcagaacggtgagcaacagcaa
aactttcagttaagtacctcaatgaaatatgggcgagaagctgatcccgaacgtgcaggg
cgagtatttcgccagcaattgaaaacgggattgccttctgaattgatagaaagaaacctt
gatgatattgaaaagcaaagtgcagaaaaggattttgatccagtagcattcagaaataaa
tcaccgcttctttctggttggctgcagaagcctgaaaacgccaaagtctctcatgatgat
ttagaaaaccttagcacaatggagtggttgttccgtgcgccggtggaagcgtaccaggac
ggagccgatcaagttcgtcttggtgggctgcgttataagcaaatgacctcacagctaaat
gataacgaattacaatttattgatgcgtataaaaagcgtggccctcgctcatacggcgct
gatagttggatcggtgaggcgtttgttggtgctacaggccaactgtcacagtttgcaccg
atgattgaggagggtttgaaatacggcgttcctgctggtttaactgctggtacttttgcg
cttgctgctggtcaagcgggtccacaaatagcattacctgaagaaatattcacggtgcca
ggtgcaaccgctttaggtttatctagtggttttgcttatggtaaagcaaagcaatccttt
gagctgcagaccggtcttgcttatgacgagtttaaagactttaaagatattaacgggcat
ccacttgatgatgatgtagcaaaaggggctgctttttttgccggtgcatttaatgccggt
cttgattttgtcgcgcttgataaattaatcgaaaccatacctggtgcaaaaaatattatg
tctggtggtgcgactgcagttattaagcaggcattaaaaaatccaaccgtgaccgaagga
ttaaaacgattttctactgagtatgggaaaagtgtttccgcccaggtgatgattgatgcg
gggcaagaactggtgcaaatgattgccggtgaaacagcgaagcgttaccaggggaacttt
gaaaattctgacatggtcgcaattggtgatcgaatggttgaggcgttagacgcttcatta
aaagcaaatgtcgttttatctgctcctggtcattctatgacgttaacgggtgatttatta
aaaagtcgtcaggcgcaacaaaataagcaaatcatgcaacagcttggtaattctacgcaa
caatcaaagttacatgcccgagcgcccgagaaagtgcgtgaattaatggcaaccgtaaaa
gaaaacggtcccgttcaagatgtaatgatcccagtagaacagtggaacactctttttcag
tctgaaagtgttgatcctttatcaatggccgctgagattttgggtgatgatggaatgcaa
tatcgtgaagctgcagcgaccggcagtgacattatgatcccgcttgatgtgtatacagaa
aaattagcgggtagtcagtatcataatatgcttttggatgacatgcgcttcgagcctgac
caaatgacggcgcgtgaggctgcagcgtgggacgcaagcaatcagcaaaacattgagcaa
caggctgctagtattgctgatttcattactcaaccagacgaaacgcaatttatttttgat
gatattgtcggccagctaaaaaacaccggcatggaaatgggtaccgccgaaaccaacgca
attcaaatgcagtctttttttagaacgctttcatcacgcaccggcatcgatgcaaaaaaa
ttatggtcacagtacgggcctaaagttactcgagagatgcccgaggtattaaaaagtgca
ggaggtaattttgatattgccgttgatccaattcttgatcgtattcgcgcgaatgatatt
cctgaactttcagatattcagggtaaaacgatgcttgaaaccttgcgtgaaaaaggaatc
caagatgttggcggagaactttctgcccgtgatgttgatgtgaaactaaaacctttccag
aaaaaattgatttctgaaagtggcgttactttggatgatgcagcccaacttatggccgag
gctggttacatccctgcagacattgatagtgtgacgcagaatgacttgcttgaagctatt
gatcgtgaaatggccggtgatcctgtttacagccagcttaatgaaaacgctaaagcctta
gaggaccgtgaaacgcttttatcaatgtccggttatcttgaggatttaggtatcgatgtt
tcccaggtaagcaatcaggatattaagcagcaattatcaaaccagatagccaatgagggt
gacggcgtaacgcttaatcaagcagagcgcggtgaaatcaagataagccaagacaagaaa
tttcaaattacattttttaaaaatgctgatttatcaactttactccatgaatcaggacat
atgtattttgaaatactgcaggacatagataaaaaaggcatggcgtcagaatctatttct
aacgatttaaaaaccgttcgtgattgggttggtgctaaggatggtaaagatataaccaca
gaacagcatgaacagtttgccagaggttttgagcaatacctgagagaaggtaaagcccct
acaacagaattacagtcagcctttgcccgtttccgtgcgtggctggttacgatttatcgc
caggcttcaaaacttaatgtggatgtttctgaagatgtgcgccaggtgtttgatcgcatg
ttggcaactgacgaccaaatcaaagctgctgagactcaaatggaatataaccgactgttt
gaagatgccgaaagcgcgggaatgactgaggcggaatttaaccgttatcaaaaagacgcc
acacttgcacgcgaacaggcgcaagaagaagtgaccgtgaaagcatttaacgaaatgcag
cgtgagcaaaaaaagtggtggaaagatgccgaaatcgatatgcgtgatcaggtcatggct
gagatggccgaaaacccaacttaccaggcggttaattatctgcagaaaggcaagctgctc
gatatggatttacctgaaggggttgaggcgctaaagctaagtaaaaatgcccttgtcgag
aagtacggaaaacaatttcttaaattattacctcgcccgtacatctataccaagaccggt
ggtgctcatcccgaccaaatagctgtgcttttcggtttcagctctggtgatgaaatgatg
caattaatcgttaacgctaggccgatgaaagacgttgttaacgccgaagtagataccaga
atgcgccagcaatacggcgatatgatgaatgacggaacattaccagaaaccgctatggat
gcggcacataatgatcgaagggcgagtgttcttgctgcagaactgaaagcactatcacgc
cgagtttcaagccgtggcgctcccacacctgcagcaatgatgaagcaagcagctcagact
gtggttgaccgtaaaaccgttagaagtctaaagcctagcgtttatcttaatgctgaacga
aaagctgcgaaacaggcacttgaagcggtgcttgcaggtgattacgctgcggcagcagac
gcgaagcaaaggcagcttttaaatttctacatgggtaactacaccaaaaaggcaaaagca
gaaacggataaatcacgcgattacctaaacagctttaaccgacctaaaaaacgccaggct
ttaggtaaggctggtcacgattatcttgaccaaatcgatgctttgttagaaaagacagaa
tttaaacgtgtttcacttattagcctggaccgtagaaaatcgctttctgaatttatccaa
aatcaggaggagcaaggctggactgttgagatccctgaatcactggttaagcaaacacag
tcgcgaaactggaaagatatgacagtcgaggaattaacaggtttacgtgatgctgttaaa
aatattgattatcttgctcgtttcaaaaataaattattacgccaggacgaaaagcgaaaa
tttgaagaaattgtcgatgctgcagtttcatcaattgaagcaaataatgtagtgcacgaa
attaagccaaactttgctgaaacgtggaaagaccgcgttaaggaaaatgtttctggtttt
atggcctcacatacaaaaatggaatttttctttgaatggttagacggggatagcgcgaac
ggtgaggcgtggcgatctttttacaagccgatcaatgatgctgacaataaagaaaaactg
atgcaggagtcttatacaaaacgactcgctggaatccttgatgcttacaccagtaaagaa
cgcggaaaatggtacacggacaccagccacattcaacacgttggccgtgtaaataaagca
atggcaatgtctgtcgcgcttaactggggcaacgtgggcaatcagcaagccgtacttgat
ggttatacccgtaatgatggtaaaaactggacggaaacggaagcgcagcgaatccttgaa
atgttagatcaaaaggattgggataccatccagaaggtatgggatttaattaatgacctt
tggcctgaaatatcaaagcttcaaaaagatttaactggcgtatctcctgagaaagtcgag
gcttcattaattcaaacaaaatatggcgagataaaaggtggttattacccgcttgtttat
gatcaaaagctatcttatgccgtattcaagcgtgatgaaaaagcagcgacacaagatttg
tttgaaagtaatttctcaaaaccggcaacaaaaaaaggtcacacaatcgagcgtactggt
tctggtgggcaggcggttaaactggatttatccgttatcagtgaacacattgataacgtt
atccacgatataacgcaccgacgcgcattgatggatactgaccgactaattcaaaatcct
cgggtacgtgctgctattgagaaaactgcaggccgtcaaatgtaccgacagttaagaccg
tggcttcaatcgatagccagggagcagcagccaacatttaattatgtggaaacattaatt
ggaaaagcacgcaccggtgcgaccgttgttaatatgggtttaaaagttaccactgcgatt
gctcaacctttgggtgttctcaatagtgttgatgaattgggtgttatttccatgatgaaa
ggaattaaggatttctacgccaactcaccagtaggtatgaaaaagagactcgattttgtt
acttcacgttctgccatgatgcgaaatcgacaaaagacttttgatcgagacatcaaggat
gctgcaaagcgtttaggtaaagataagaaattcgataaggtaagagaatcatttttttat
cttaccggccttcttgatatgggggttagtgtcccgacttggcttgctgcatatcgtaaa
gctcttgatggaaatgttgacggtattactgcaggtgatgaaaacacggcgattgatttt
gctgatcgtactgtgcgtgtaactcagtcggaaggtggcgcaaaagatcttgccaaaatc
cagcgaggaggggaagtttttcgctcgttcacaatgttttattcatatttcagtgtgctg
cataaccaattgagaaaacgcggcagacagtacgtgcgaggcgataccaatacgtcgcag
ttagcagcaagcatgtttttcttgtggtttgctcctgcagttcttggtgagcttgttgca
ggtcgcggccctggtgatgacgaagattgggataaatgggcactgaaagaaatttcttct
tatccgttccaaactgttgtctttgttcgcgacctggttaatgggcttggtgattttggt
tattctgccagccctgcgtttgatgcgtttgaaatgagtgttaaggctgtaaaactccca
tacaaggcgattgcaccagatgaggaagtaaagcggtcagacgtgaaagcagcggtgctg
gcagcaggatattggggccaacttccaagccgtcaagcctggataactggcgaatatgtt
tatgacatgatgacaggagaggaaaagccggaagatggatttgagatgatgcgaaatctt
atgctgactagaccgcgagattaa

DBGET integrated database retrieval system