KEGG   Photobacterium profundum: PBPRB1112Help
Entry
PBPRB1112         CDS       T00173                                 

Gene name
PA3925
Definition
(GenBank) putative acyl-CoA thiolase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
ppr  Photobacterium profundum
Pathway
ppr00071  Fatty acid degradation
ppr00072  Synthesis and degradation of ketone bodies
ppr00280  Valine, leucine and isoleucine degradation
ppr00310  Lysine degradation
ppr00362  Benzoate degradation
ppr00380  Tryptophan metabolism
ppr00620  Pyruvate metabolism
ppr00630  Glyoxylate and dicarboxylate metabolism
ppr00640  Propanoate metabolism
ppr00650  Butanoate metabolism
ppr00900  Terpenoid backbone biosynthesis
ppr01100  Metabolic pathways
ppr01110  Biosynthesis of secondary metabolites
ppr01120  Microbial metabolism in diverse environments
ppr01130  Biosynthesis of antibiotics
ppr01200  Carbon metabolism
ppr01212  Fatty acid metabolism
ppr02020  Two-component system
Brite
KEGG Orthology (KO) [BR:ppr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    PBPRB1112 (PA3925)
   00630 Glyoxylate and dicarboxylate metabolism
    PBPRB1112 (PA3925)
   00640 Propanoate metabolism
    PBPRB1112 (PA3925)
   00650 Butanoate metabolism
    PBPRB1112 (PA3925)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    PBPRB1112 (PA3925)
   00072 Synthesis and degradation of ketone bodies
    PBPRB1112 (PA3925)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    PBPRB1112 (PA3925)
   00310 Lysine degradation
    PBPRB1112 (PA3925)
   00380 Tryptophan metabolism
    PBPRB1112 (PA3925)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    PBPRB1112 (PA3925)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    PBPRB1112 (PA3925)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    PBPRB1112 (PA3925)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ppr04147]
    PBPRB1112 (PA3925)
Enzymes [BR:ppr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     PBPRB1112 (PA3925)
Exosome [BR:ppr04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   PBPRB1112 (PA3925)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: CAG22984
UniProt: Q6LI96
Position
2:complement(1258779..1260026)
Genome map
AA seq 415 aa AA seqDB search
MEKTIWIVSAKRTPLGSFQGKLKAFSAPQLGQFAIKAALDAVPISPDCINEVFMGCVLTA
GCGQAPARQAALGAGLSYSVGCTTINKVCGSGMKSVMLAHDLIKAGSIGCAVAGGMESMS
NAPYLLKESRNGMRIGHKTTYDHMFLDGLQDAYEGDLMGVYAQHIADRLNYTREQMDEWA
TMSVQRSLDAQTQQLFTDEIVPISLSTKGAAAPEDGTNTHNSKTLDYDEHPREVDLQKIP
KLTPVFAMHGTVTAANSSAISDGAAALVVMNAEIAQQQGLEPLAIIRGHTTHARKPAEFT
LAPVYAIEQLLSKLDWSIDEVDLWEINEAFAVVTQIAVRQLGLDIDKVNIKGGACALGHP
IGASGARILVTLIHSLRQIQALDTEHEPNKKVMRGVASLCIGGGEATAMGIEIPL
NT seq 1248 nt NT seq  +upstreamnt  +downstreamnt
atggaaaaaaccatttggattgtatctgcaaaacgtacaccgttaggtagctttcaaggc
aagcttaaagcgttttctgcccctcaattagggcaatttgccatcaaggctgcacttgat
gcggtgcctatttcacctgattgtatcaatgaagtttttatgggttgtgtattgactgcg
ggctgcggtcaagcgcctgctcgtcaagcggctttaggagcagggctgtcgtattctgtt
ggttgcacgacgattaataaagtctgcggttcagggatgaaatcagtcatgttagcgcat
gatttgattaaggctgggtcaataggttgtgctgttgctggtggtatggaaagcatgagc
aacgcaccatacctcctgaaggagtcacgcaatggtatgcggatcggtcataaaacaacg
tatgaccatatgtttctagatggcttacaagatgcgtatgaaggcgacttaatgggtgtg
tatgctcaacatattgccgataggttaaattacaccagagagcagatggatgaatgggcg
actatgtcggttcaacgctctttagatgcgcaaacacagcagttatttaccgatgaaata
gtgccaatttcgttatcaactaaaggtgcggcagcaccagaagacggtacgaatacacat
aacagtaagacgttagattacgatgaacaccctcgcgaagtagatctccaaaaaatcccc
aagctcactcctgtatttgcgatgcacggtactgtaacagcagcaaattcaagtgcgatt
tccgatggtgctgctgcattagtggtgatgaatgctgaaattgcgcagcaacaaggatta
gagcctcttgccattatcagggggcataccacacatgctcgtaagccagcagaattcaca
cttgcgcctgtttacgctattgaacaattgttatctaaattagattggtcgattgatgaa
gttgatttatgggaaatcaatgaagctttcgctgtggttacacaaatagcggtgcgccaa
ttaggtttagatattgataaggtaaatattaaaggaggcgcgtgtgcgcttgggcatccc
attggtgccagtggtgcacgtattctggttacgcttattcatagcctgaggcagattcaa
gcattagataccgaacatgaacctaataaaaaagtgatgcgcggcgttgcttcactttgt
attggagggggagaagcgacagcaatgggtatcgaaattccgctataa

DBGET integrated database retrieval system