KEGG   Photobacterium profundum: PBPRB1599
Entry
PBPRB1599         CDS       T00173                                 

Gene name
AGR_PTI_
Definition
(GenBank) hypothetical TrbD protein
  KO
K20529  type IV secretion system protein TrbD
Organism
ppr  Photobacterium profundum
Pathway
ppr02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:ppr00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    PBPRB1599 (AGR_PTI_)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ppr02044]
    PBPRB1599 (AGR_PTI_)
Secretion system [BR:ppr02044]
 Type IV secretion system
  Trb secretion system protein
   PBPRB1599 (AGR_PTI_)
SSDB
Motif
Pfam: VirB3 Sensor Meckelin DUF4736 TcpE DUF2207
Other DBs
NCBI-ProteinID: CAG23459
UniProt: Q6LGX1
Position
2:1748431..1748724
AA seq 97 aa
MNTDEPLVCRPVFAFNRSHLFLGGERELVLSMVLLCIVLIVALQNIYTAMMGVVLLIVSI
TVARMMAKSDPQLTKTYRRFARYQRFYPSNGMKQYGG
NT seq 294 nt   +upstreamnt  +downstreamnt
atgaatactgacgaaccgttagtctgccgccctgtatttgcgtttaaccgcagccatttg
ttcctgggcggagagcgcgaattagtcctgagtatggtgctgttgtgtatcgtattgatt
gtggccctgcaaaacatctataccgccatgatgggcgttgtgttgctcattgtatccatc
acggtggcccgcatgatggccaaatccgatccgcaattaaccaaaacataccgccgcttt
gcacggtaccaacggttctatccgtcaaacggcatgaaacagtacgggggataa

DBGET integrated database retrieval system