KEGG   Photobacterium profundum: PBPRB1786Help
Entry
PBPRB1786         CDS       T00173                                 

Gene name
VV20768
Definition
(GenBank) putative adenylosuccinate synthase
  KO
K01939  adenylosuccinate synthase [EC:6.3.4.4]
Organism
ppr  Photobacterium profundum
Pathway
ppr00230  Purine metabolism
ppr00250  Alanine, aspartate and glutamate metabolism
ppr01100  Metabolic pathways
Module
ppr_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
Brite
KEGG Orthology (KO) [BR:ppr00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    PBPRB1786 (VV20768)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    PBPRB1786 (VV20768)
Enzymes [BR:ppr01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.4  adenylosuccinate synthase
     PBPRB1786 (VV20768)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Adenylsucc_synt VioE
Motif
Other DBs
NCBI-ProteinID: CAG23645
UniProt: Q6LGD5
Position
2:complement(1952035..1952292)
Genome map
AA seq 85 aa AA seqDB search
MSSIVVVGANWGDEGKGRIVDYLAGGASASIRFQGGNNAGHTVVNDFGTFKLHQLPSGVF
NPDCIAVLGPGMVISPAPLLKISRS
NT seq 258 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtctattgttgttgttggtgctaactggggtgatgaaggtaaaggtcgcattgta
gattatttggcaggtggtgcatctgcaagtattcgctttcaaggtggtaacaatgcaggc
cataccgttgttaatgacttcggaacattcaaattacaccaactaccaagcggcgtattc
aaccccgactgtattgcggtgctaggtcctggcatggtgataagccctgcgcctttactg
aagattagcagaagttaa

DBGET integrated database retrieval system