KEGG   Photobacterium profundum: PBPRC0014Help
Entry
PBPRC0014         CDS       T00173                                 

Definition
(GenBank) hypothetical sex pilus assembly and synthesis protein (TraF)
  KO
K12057  conjugal transfer pilus assembly protein TraF
Organism
ppr  Photobacterium profundum
Brite
KEGG Orthology (KO) [BR:ppr00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ppr02044]
    PBPRC0014
Secretion system [BR:ppr02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   PBPRC0014
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TraF
Motif
Other DBs
NCBI-ProteinID: CAG17952
UniProt: Q6LW83
Position
pPBPR1:12808..13599
Genome map
AA seq 263 aa AA seqDB search
MTLTPSLPFGALFFTTPLLVMAILTSPVTRAEQPPGWKWYNDPLLIKEKALTPPPPTPSV
TVTRTLSPTQQMQWFHRYHDDTKNDALINKDDVKKAEKLMLLNQFAYNMSSDFGMTFQKA
LLMNPDLSYTKDRPTEQAARSTYLQMEREKKIRAVRQLAGSGWGLFFVYEGASPMAEKLA
PSVQQFADAHGIEVLGISLDGTQLASIHQNRDNSNHIQVPFSPALVLVNPNTQEMKPLAY
GFIAQEDLLGRFLNVATDFAPDF
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atgacactgacaccctcattgcccttcggggcactgttttttaccactcctttattagtg
atggccatactgaccagcccagtcacccgtgccgaacaaccacccggttggaagtggtat
aacgatccgttattgatcaaagaaaaagccctgacaccaccaccgcccaccccgtcggtc
acggtgacacgcactctctcaccgacccagcaaatgcaatggtttcatcgctaccacgat
gacaccaagaacgatgccctgattaataaggacgatgtaaaaaaggcagaaaagctcatg
ctgctcaatcaatttgcgtacaacatgtcgtctgattttggcatgacctttcaaaaagcc
ctgctcatgaacccggacctgtcctacaccaaagaccgtccgacggaacaagccgcccgc
tccacctacctgcagatggagcgggaaaagaaaattcgggccgtgcgccaactggcaggt
agtggctggggcttatttttcgtctatgaaggggcttcccccatggccgaaaaactggct
ccctcagtacaacaatttgctgatgcccacggcattgaggtacttggcattagccttgac
ggtacacagctggccagcattcaccagaatcgggataacagcaatcatatccaagtgccc
tttagtcccgccttggtcctggtcaaccccaacacccaagaaatgaaacccctcgcctac
gggttcattgctcaagaagacttattggggcgctttttgaacgtcgccactgactttgcc
cctgacttttaa

DBGET integrated database retrieval system