KEGG   Pseudomonas protegens CHA0: PFLCHA0_c02810Help
Entry
PFLCHA0_c02810    CDS       T02671                                 

Gene name
ompR1
Definition
(GenBank) transcriptional regulatory protein OmpR
  KO
K07659  two-component system, OmpR family, phosphate regulon response regulator OmpR
Organism
pprc  Pseudomonas protegens CHA0
Pathway
pprc02020  Two-component system
Brite
KEGG Orthology (KO) [BR:pprc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    PFLCHA0_c02810 (ompR1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:pprc02022]
    PFLCHA0_c02810 (ompR1)
Two-component system [BR:pprc02022]
 OmpR family
  EnvZ-OmpR (osmotic stress response)
   PFLCHA0_c02810 (ompR1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Response_reg Trans_reg_C
Motif
Other DBs
NCBI-ProteinID: AGL82082
UniProt: A0A2C9EEK9
Position
325040..325780
Genome map
AA seq 246 aa AA seqDB search
MSSTVQTAEGEKILIVDDDPGLSSLLERFFVSKGYRARAVPNTEQMDRLLGREVFNLVVL
DLMLPGEDGLTACRRLRSANNQIPIIMLTAKGDELSRIKGLELGADDYLAKPFNPDELMA
RVKAVLRRQSAPVPGAPGSEDESVTFGDYELSLATRELKRGNEVHMLTTGEFAVLKALVM
NARQPLTRDKLMNLARGREWDALERSIDVQISRLRRMIEPDPSKPRYIQTVWGVGYVFVP
DGTATK
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atgagcagcactgtacaaactgctgaaggcgaaaaaattcttattgttgacgacgacccg
gggctgagcagcctgctggagcgtttcttcgtcagcaagggctaccgtgcccgcgcagta
cctaacaccgagcaaatggaccgcctgctgggtcgcgaagtgttcaacctggtggtactc
gacctgatgctgcccggcgaagacggcttgaccgcatgccgccgcctgcgcagcgcgaac
aaccagattccgatcatcatgctcaccgccaagggcgacgagctgagccgcatcaagggc
ctggaactgggcgccgacgattacctggccaagccgttcaatcccgacgagctgatggcg
cgggtcaaggccgtattgcgtcgccagtctgccccggtgccgggtgcgccgggcagcgaa
gacgaaagcgtgaccttcggcgactacgagttgtccctggccacccgcgagctcaagcgc
ggcaatgaagtgcacatgctcaccaccggtgaattcgcggtgctcaaggcgctggtgatg
aacgcccgccagccgctgacccgggacaagttgatgaacctggcccgtggtcgcgaatgg
gacgccctggagcgctccattgacgtgcagatctcccgcctgcgtcggatgatcgagccc
gatccttccaagccgcgctacatccagaccgtctggggcgtgggttatgtctttgtgccg
gatggcaccgcgaccaagtga

DBGET integrated database retrieval system