KEGG   Pseudomonas protegens CHA0: PFLCHA0_c19520Help
Entry
PFLCHA0_c19520    CDS       T02671                                 

Gene name
hemN
Definition
(GenBank) oxygen-independent coproporphyrinogen-III oxidase HemN
  KO
K02495  oxygen-independent coproporphyrinogen III oxidase [EC:1.3.98.3]
Organism
pprc  Pseudomonas protegens CHA0
Pathway
pprc00860  Porphyrin and chlorophyll metabolism
pprc01100  Metabolic pathways
pprc01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pprc00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    PFLCHA0_c19520 (hemN)
Enzymes [BR:pprc01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.98  With other, known, physiological acceptors
    1.3.98.3  coproporphyrinogen dehydrogenase
     PFLCHA0_c19520 (hemN)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Radical_SAM HemN_C
Motif
Other DBs
NCBI-ProteinID: AGL83734
UniProt: A0A2C9EJC1
Position
complement(2156405..2157787)
Genome map
AA seq 460 aa AA seqDB search
MLDAIRWDTDLIRRYDLAGPRYTSYPTAVQFNSQVGAFDLLHALRDSRKAQRPLSLYVHI
PFCANICYYCACNKVITKDRSRALPYLQRLEQEMQLIACHLAPNQRVEQLHFGGGTPTFL
NHDELRQLMALLRKHFNLLDDDSGDYGIEIDPREADWSTMGLLRELGFNRVSIGLQDLDP
AVQRAVNRLQSLDETRAVIEAARTLQFRSINIDLIYGLPKQTPENFARTVEEVISLQPDR
LSVFNYAHLPERFMPQRRINGSELPAPAEKLQMLQRTIEQLTAAGYRYIGMDHFALPDDE
LAIAQEESTLQRNFQGYTTHGHCDLIGLGVSAISQIGDLYCQNSSDLTHYQNALAGAQLA
TSRGLVCNADDRLRREVIQQLICNFSLKFEEIEQAFNIDFRGYFNELWPELEEMADDGLI
ELGSEAIIVLPAGRLLVRSVCMVFDAYLGQQNRQRFSRVI
NT seq 1383 nt NT seq  +upstreamnt  +downstreamnt
atgctcgacgccattcgttgggacacagatctgatccgccgctacgacctggcgggaccg
cgctacacctcatacccgaccgcagtgcagttcaacagccaggtcggcgccttcgacctg
ctgcacgccctgcgcgacagccgcaaggcgcagcgcccgctgtcgctgtacgtgcacatc
ccgttctgcgccaacatctgctactactgcgcctgcaacaaggtcatcaccaaggatcgc
agccgcgccctgccctacctgcagcgcctggaacaggagatgcaactgatcgcctgccac
ctggcccccaaccagcgggtggaacaactgcatttcggcggcggcaccccgacctttctc
aaccacgatgaactgcgccaactgatggccctgctgcgcaagcacttcaatctgctggac
gacgactccggcgactacggcatcgagatcgatccccgggaagccgactggtcgaccatg
ggcctgttgcgggagctgggtttcaatcgggtcagcatcggcctgcaggacctggacccg
gcagtgcaacgcgcggtcaatcgcctgcaaagcctggacgaaacccgggcggtgatcgaa
gcggcccgcaccctgcagttccgttccatcaacatcgacctgatctacggcctgcccaag
cagaccccggaaaacttcgcccgcaccgtggaagaagtcatcagcctgcaaccggaccgg
ctctcggtgttcaactacgcccacctgccggagcgtttcatgccccagcggcggatcaac
ggcagcgaactgcctgccccggcggaaaagctgcagatgctgcaacgcaccatcgaacag
ctgacggctgccggctatcgctacatcggcatggaccatttcgccctgcccgatgatgaa
ctggccattgcccaggaagagtccaccctgcaacgcaacttccagggctacaccactcat
ggtcattgcgaccttattgggctcggtgtttcagccatcagccagatcggcgatctctac
tgccagaacagcagcgacctgacgcactatcaaaatgccttggctggcgcacaactggcc
accagtcgcggcttggtatgcaacgccgatgaccgtctgcgccgggaagttattcagcaa
ctgatctgcaactttagtcttaagttcgaagagatcgaacaggctttcaatatcgacttt
cgcggctacttcaatgaactctggccggaactggaagagatggccgacgacggcctgatt
gaacttggcagcgaagcaatcatcgtgctgccagccggtcgcctactggtgcgctcggtg
tgcatggtgttcgatgcatacctgggccagcagaaccgccagcggttttcccgtgtgatc
tag

DBGET integrated database retrieval system