KEGG   Pseudomonas protegens CHA0: PFLCHA0_c19840Help
Entry
PFLCHA0_c19840    CDS       T02671                                 

Gene name
rlmM
Definition
(GenBank) ribosomal RNA large subunit methyltransferase M
  KO
K06968  23S rRNA (cytidine2498-2'-O)-methyltransferase [EC:2.1.1.186]
Organism
pprc  Pseudomonas protegens CHA0
Brite
KEGG Orthology (KO) [BR:pprc00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:pprc03009]
    PFLCHA0_c19840 (rlmM)
Enzymes [BR:pprc01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.186  23S rRNA (cytidine2498-2'-O)-methyltransferase
     PFLCHA0_c19840 (rlmM)
Ribosome biogenesis [BR:pprc03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    PFLCHA0_c19840 (rlmM)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RlmM_FDX FtsJ
Motif
Other DBs
NCBI-ProteinID: AGL83765
UniProt: A0A2C9EJG7
Position
2200085..2201158
Genome map
AA seq 357 aa AA seqDB search
MNTLFIHCRPGFEGEVCSEIADHAARLNVAGYAKAKPSTACAEFICTEDDGAQRLMQGLR
FPELIFPRQWARGGFIDLPETDRISVILAYLANFPQCGSLWLEVVDTNDGKELSNFCKKF
EAPLRKALTAAGKLVDDATKPRLLLTFKSGREVFVGLADAGNSAMWPMGIPRLKFPREAP
SRSTLKLEEAWHHFIPRDQWDERLHGDMTGVDLGAAPGGWTWQLVNRGMLVTAVDNGPMA
ESLMDTGLVQHLMADGFTYKPRQPVDWMVCDIVEKPARNAALLETWIGEGHCREAVVNLK
LPMKQRYAEVKRLLERIEEGFKARGIRVAIGCKQLYHDREEVTCHLRRLDLKKPKSA
NT seq 1074 nt NT seq  +upstreamnt  +downstreamnt
atgaacaccctgtttatccattgccggcccggcttcgagggcgaagtctgctccgagatc
gccgaccacgcggcccggctgaatgtcgccggttatgccaaggccaagcccagcaccgcc
tgcgccgagttcatctgcaccgaggacgacggggcccagcgtctgatgcagggcctgcgc
ttcccggagctgatctttccccggcagtgggcccggggcggcttcatcgacctgccggaa
accgaccgcatcagcgtgatccttgcctacctggccaacttcccgcagtgcggcagtctg
tggctggaagtggtggacaccaacgatggcaaggagctgtccaacttctgcaagaagttc
gaagcccccctgcgcaaggccctgaccgcggccggcaagctggtggacgacgcgaccaag
ccacgcttgttgctgaccttcaagagcggtcgggaagtcttcgtcggcctggctgatgcc
ggcaactcggccatgtggcccatgggcattccacggctgaaattcccccgggaagcgccg
agccgctcgaccctgaagctggaagaggcctggcaccatttcattcctcgggaccagtgg
gacgagcgtctgcatggcgacatgaccggcgtcgacctgggggctgccccgggcggctgg
acctggcaactggtcaaccgcggcatgctggtgaccgccgtggacaacggccccatggct
gaaagcctgatggacaccggcctggtgcagcacctgatggcggacggctttacctacaag
cccaggcagccggtggactggatggtctgcgacatcgtcgagaaaccggcgcgcaacgcc
gcgctgctggagacctggatcggcgaggggcactgccgcgaggcggtggtcaacctcaag
ctgccgatgaagcagcgctatgccgaagtgaagcgcttgctggagcgcatcgaagaaggc
ttcaaggcccggggcattcgcgtggccattggctgcaagcagctgtaccacgaccgcgag
gaagtcacctgccacctgcggcgcctggatctgaaaaagcccaaatcggcgtag

DBGET integrated database retrieval system