KEGG   Pseudomonas protegens CHA0: PFLCHA0_c30630Help
Entry
PFLCHA0_c30630    CDS       T02671                                 

Definition
(GenBank) putative lipoprotein
Organism
pprc  Pseudomonas protegens CHA0
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Tgi2PP YbgT_YccB
Motif
Other DBs
NCBI-ProteinID: AGL84833
UniProt: A0A2C9EME1
Structure
PDB: 

Position
complement(3419075..3419545)
Genome map
AA seq 156 aa AA seqDB search
MLKLKSPSWVLGLSLACTTLVACATDSLQPARIKDSGLTREQAEQVLRVALKHQDYQLQR
PGVFIDGDLQDENGKPPHPGYYDFSLGYNDPKAGATEYWGLFSVSLNTGDTWEINSCKRL
DGAELRALQRRVMARTGKSLADEKSQREGLGCEDQQ
NT seq 471 nt NT seq  +upstreamnt  +downstreamnt
gtgctgaaactcaagagtccttcctgggtgcttggcctgtccctggcctgcaccacactg
gtggcctgcgccaccgatagcctgcagccggcgcggatcaaggacagcggcctgacccgc
gaacaggcggagcaggtcctgcgggtggccctcaagcaccaggactatcagttgcagcgc
cccggggtgttcatcgacggcgacctgcaggacgaaaacggcaagccgccccatcccggg
tactacgacttcagcctcggctacaacgaccccaaggccggggccaccgagtactggggc
ctgttctcggtcagcctgaacacgggcgatacctgggaaatcaacagctgcaagcgcctt
gatggcgccgagctgcgagccttgcagcggcgggtcatggcccgcaccggcaagagcctg
gcggatgaaaaaagccagcgcgagggcctgggctgcgaagaccaacaataa

DBGET integrated database retrieval system