KEGG   Pseudomonas protegens CHA0: PFLCHA0_c30940Help
Entry
PFLCHA0_c30940    CDS       T02671                                 

Gene name
thlA1
Definition
(GenBank) acetyl-CoA acetyltransferase ThlA
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
pprc  Pseudomonas protegens CHA0
Pathway
pprc00071  Fatty acid degradation
pprc00072  Synthesis and degradation of ketone bodies
pprc00280  Valine, leucine and isoleucine degradation
pprc00310  Lysine degradation
pprc00362  Benzoate degradation
pprc00380  Tryptophan metabolism
pprc00620  Pyruvate metabolism
pprc00630  Glyoxylate and dicarboxylate metabolism
pprc00640  Propanoate metabolism
pprc00650  Butanoate metabolism
pprc00900  Terpenoid backbone biosynthesis
pprc01100  Metabolic pathways
pprc01110  Biosynthesis of secondary metabolites
pprc01120  Microbial metabolism in diverse environments
pprc01130  Biosynthesis of antibiotics
pprc01200  Carbon metabolism
pprc01212  Fatty acid metabolism
pprc02020  Two-component system
Brite
KEGG Orthology (KO) [BR:pprc00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    PFLCHA0_c30940 (thlA1)
   00630 Glyoxylate and dicarboxylate metabolism
    PFLCHA0_c30940 (thlA1)
   00640 Propanoate metabolism
    PFLCHA0_c30940 (thlA1)
   00650 Butanoate metabolism
    PFLCHA0_c30940 (thlA1)
  Lipid metabolism
   00071 Fatty acid degradation
    PFLCHA0_c30940 (thlA1)
   00072 Synthesis and degradation of ketone bodies
    PFLCHA0_c30940 (thlA1)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    PFLCHA0_c30940 (thlA1)
   00310 Lysine degradation
    PFLCHA0_c30940 (thlA1)
   00380 Tryptophan metabolism
    PFLCHA0_c30940 (thlA1)
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    PFLCHA0_c30940 (thlA1)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    PFLCHA0_c30940 (thlA1)
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    PFLCHA0_c30940 (thlA1)
Enzymes [BR:pprc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     PFLCHA0_c30940 (thlA1)
Exosome [BR:pprc04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   PFLCHA0_c30940 (thlA1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AGL84864
UniProt: A0A2C9EMI3
Position
complement(3449372..3450562)
Genome map
AA seq 396 aa AA seqDB search
MSIAQDPIVIVSAVRTPMGGFQGDLKGLSAPQLGSEAIRAAVQRAGIAPQAVEEVLFGCV
LSAGLGQAPARQAALGAGLDKGTRCTTLNKMCGSGMEATILAHDMLLAGSAEVVIAGGME
SMSNAPYLLDRARSGYRMGHGKVLDHMFLDGLEDAYDKGRLMGTFAEDCAEANGFTRQAQ
DDFAVASLTRAQQAIKDGLFKDEIVPLQVMVGKESKLISDDEQPPKAKLDKIPTLKPAFR
DGGTVTAANSSSISDGAAALVLMRRSEADKRGLKPLAVIHGHAAFADTPGLFPVAPVGAI
ERLMKKTGWSLNEVDLFEINEAFAVVSLVTMSKLEIPHAKVNVHGGACALGHPIGASGAR
ILVTLLSALRQKGLKRGVAAICIGGGEATAMAVECL
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgtccattgcccaagatccgattgtcatcgtcagcgccgtccgtacccccatgggcggt
ttccagggggacctcaaaggcctcagcgcgccgcaactggggagcgaagccattcgcgcc
gcagtccagcgcgccggcattgcaccgcaggcggtcgaagaagtgctgttcggctgcgtg
ctgtccgccggcctcggccaggccccggcccgtcaggccgccctgggcgccggcctggac
aagggcacccgctgcaccaccctgaacaagatgtgcggttccggcatggaggccaccatc
ctggcccacgacatgctgctggccggcagtgccgaggtggtgatcgccggtggcatggaa
agcatgtccaacgccccgtacctgctggaccgcgctcgcagcggctaccgcatgggccac
ggcaaggtgctggaccacatgttcctcgacggcctggaagacgcctacgacaagggccgc
ctgatgggcaccttcgccgaggattgcgccgaggccaacggcttcacccgccaggcccag
gacgatttcgccgtggcttccctgacccgtgcccagcaggcgatcaaggatggcctgttc
aaggacgagatcgttcccctgcaggtgatggtcggcaaggagtcgaagctgatcagcgac
gacgagcagccgcccaaggccaagctggacaagatccccaccttgaaaccggcgttccgc
gacggtggcaccgtgactgcggccaactccagctcgatctccgacggcgccgcggccctg
gtgctgatgcgccgctccgaagctgacaagcgcggcctcaagcccctggcagtgatccac
ggccacgcggccttcgccgatacccccgggctgttcccggtggccccggtgggtgccatc
gagcggctgatgaagaagaccggctggtcgttgaacgaggtcgacctgttcgagatcaac
gaagccttcgccgtggtcagcctggtcaccatgagcaagctggaaatcccccacgccaag
gtcaacgtgcacggcggcgcttgcgccctgggccacccgatcggcgcttccggtgcgcgg
atcctggtgaccctgctgtcggccctgcgccagaaaggcctcaagcgtggcgtggccgcg
atctgcatcggcggtggtgaagccacggccatggccgttgaatgcctgtaa

DBGET integrated database retrieval system