KEGG   Pseudomonas protegens CHA0: PFLCHA0_c33950Help
Entry
PFLCHA0_c33950    CDS       T02671                                 

Gene name
bdhA2
Definition
(GenBank) (R,R)-butanediol dehydrogenase BdhA
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
pprc  Pseudomonas protegens CHA0
Pathway
pprc00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:pprc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    PFLCHA0_c33950 (bdhA2)
Enzymes [BR:pprc01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     PFLCHA0_c33950 (bdhA2)
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     PFLCHA0_c33950 (bdhA2)
    1.1.1.-  
     PFLCHA0_c33950 (bdhA2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2
Motif
Other DBs
NCBI-ProteinID: AGL85165
UniProt: A0A2C9ENE5
Position
3806612..3807679
Genome map
AA seq 355 aa AA seqDB search
MIKALQWHAARDLRLTQLEPRQPGPGEVLLQVAYCGICGSDLHEYVDGPHSIPQQVAHPL
SGCRAPLTLGHEFCGQVVALGQGVDARLLGQRVAVEPEYRCGECSYCQMGQYNLCESMGF
IGLMGDGGFAEQAVVPAYMLHLLPDSVSFKQAAVLEPAAVAYHALNQSSLMAGDSCAVFG
LGPIGLLLVLLARLRGVERIYAVDLDPERRRLALEFGASEALDGADPQLQARLRQLSAGG
IDSAFEAAGSQQTLSHALHCLRKGGEAVLVGLMGDVQFDAFHLVNNELRLLGSVGYRHVY
PELIQLLASGRLDLSRAVTRCLALEQAVEQGFQALLQDKSQIKVLVNPTPALADA
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
atgatcaaagcactgcaatggcatgccgcccgcgacctgcgcctgactcagctggaaccg
cgccagcccggccccggcgaggtgttgctgcaagtcgcctactgcggcatctgcggcagc
gacctgcatgagtacgtcgatggccctcactccatacctcagcaggtggctcacccgctg
tccggttgccgggcgccgctgaccctgggccacgagttctgcggccaggtagtagccctg
ggccagggcgtggatgcacggctattgggccagcgggttgcggtggaacccgaataccgc
tgcggcgagtgctcgtactgccagatgggccagtacaacctctgtgaatccatgggcttt
atcggcctgatgggcgacggcggctttgccgaacaggcggtggtaccggcctacatgctg
cacctgctgccggacagcgtcagcttcaagcaggcggccgtgctggagccggcagcggtg
gcctaccacgccttgaaccagagcagcctgatggccggcgacagttgcgcggtgttcggc
ctggggcccatcggcctgctgctggtgctactggcacggttgcgaggggtggaacggatc
tacgccgtggacctggaccccgagcgccggcgcctggccctggagttcggcgcctctgag
gccctggacggcgccgacccgcaactgcaggcacgcctgcggcagctgagcgccggtggt
atcgacagcgcctttgaggccgccggcagccagcagaccctgagccatgccctgcactgc
ctgcgcaagggcggcgaagcggtgctggtgggcttgatgggcgacgtgcagttcgatgcc
ttccacctggtgaacaacgagttgcgcctgctcggcagcgtcggctaccgccacgtctac
cccgaactgatccagctgctggccagcgggcgcctggacctgagccgggcggtcacccgc
tgcctggccctggaacaggcggtggagcaaggcttccaggcgctgttgcaagacaagagc
cagatcaaggtgctggtcaacccgaccccggccctggccgatgcctga

DBGET integrated database retrieval system