KEGG   Pseudomonas protegens CHA0: PFLCHA0_c36850Help
Entry
PFLCHA0_c36850    CDS       T02671                                 

Definition
(GenBank) hypothetical protein
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
pprc  Pseudomonas protegens CHA0
Pathway
pprc00071  Fatty acid degradation
pprc00072  Synthesis and degradation of ketone bodies
pprc00280  Valine, leucine and isoleucine degradation
pprc00310  Lysine degradation
pprc00362  Benzoate degradation
pprc00380  Tryptophan metabolism
pprc00620  Pyruvate metabolism
pprc00630  Glyoxylate and dicarboxylate metabolism
pprc00640  Propanoate metabolism
pprc00650  Butanoate metabolism
pprc00900  Terpenoid backbone biosynthesis
pprc01100  Metabolic pathways
pprc01110  Biosynthesis of secondary metabolites
pprc01120  Microbial metabolism in diverse environments
pprc01130  Biosynthesis of antibiotics
pprc01200  Carbon metabolism
pprc01212  Fatty acid metabolism
pprc02020  Two-component system
Brite
KEGG Orthology (KO) [BR:pprc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    PFLCHA0_c36850
   00630 Glyoxylate and dicarboxylate metabolism
    PFLCHA0_c36850
   00640 Propanoate metabolism
    PFLCHA0_c36850
   00650 Butanoate metabolism
    PFLCHA0_c36850
  09103 Lipid metabolism
   00071 Fatty acid degradation
    PFLCHA0_c36850
   00072 Synthesis and degradation of ketone bodies
    PFLCHA0_c36850
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    PFLCHA0_c36850
   00310 Lysine degradation
    PFLCHA0_c36850
   00380 Tryptophan metabolism
    PFLCHA0_c36850
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    PFLCHA0_c36850
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    PFLCHA0_c36850
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    PFLCHA0_c36850
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pprc04147]
    PFLCHA0_c36850
Enzymes [BR:pprc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     PFLCHA0_c36850
Exosome [BR:pprc04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   PFLCHA0_c36850
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: AGL85452
UniProt: A0A2C9EP52
Position
complement(4139501..4140676)
Genome map
AA seq 391 aa AA seqDB search
MNHESVCIVAAAHTRFGRLDGSLEDLIVQVTRDVLVDAAIDAGAIDALFLGQFNSGLVPD
GFPASLMLQADPQLRFKPATRCENACASGSAAIQAGINAIRSGAAELVLVVGAEKMTGNS
TAEVTRALAGAGYQNDPQEAGLSFAQLFGQVAQRYTERYQSPLAAMAAIAVKNHANAMAN
PLAQMHRAMDFAHCNSVSPGNPLIAEPLRLTDCSLISDGAAAILLASPRRAREFRREVAI
RALSQVNDFLPMARRDVLAFEGPQLAIQGALHEAGLGLDDLAFAEVHDCFTIAELLIYEA
MGLAPKGEGHRALDEGWVNADGRLPVNLSGGLKAKGHPVGATGVSMHALGFRQLTGEPIG
LAARSPEFGLLFNMGGMAVANYASVLQAVRV
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgaaccatgaatccgtttgcatcgtcgcggcggcccacacccgctttggccgcctcgat
ggcagcctggaagacctgattgtccaggtcacccgcgacgtgttggtggacgccgccatt
gacgccggggcgatcgatgcgctgtttctcggccagttcaactccgggctggtgcctgat
ggttttcccgcgtccctgatgctccaggccgacccgcagctgcgcttcaagccggccacc
cgctgcgaaaacgcctgtgcttccggctcggcggcgatccaggccgggatcaacgcgatc
cgcagcggcgccgccgaactggtgctggtggtgggggcggaaaagatgaccggcaacagc
accgccgaggtcacccgggccctggccggggccggctaccagaacgacccgcaagaggcc
ggcctgagctttgcccaactgttcggccaagtggcccagcgctacaccgagcgctaccag
agccccctggctgccatggcggcgattgccgtgaagaaccacgccaacgccatggccaac
cccctggcgcagatgcatcgggccatggattttgcccactgcaacagcgtttcgcccggc
aacccgctgatcgccgagcccctgcgtctgaccgactgttcgctgatcagcgatggcgcg
gcggcgatcctcctcgcgtcgccgcgccgggcccgggagttccgccgtgaagtggcgatc
cgcgccctgagccaggtgaacgacttcctgcccatggcgcgccgcgacgtgctggccttc
gaaggcccgcaactggcgatccagggcgccttgcacgaagccggcctgggcctggacgac
ctggcgttcgccgaagtccacgactgcttcaccatcgccgaactgctgatctacgaagcc
atgggcctggcgcccaagggcgaaggccatcgagccctggacgaaggctgggtgaatgcc
gacggacgcctgccggtgaacctctccggggggctcaaggccaagggacatccggtgggc
gccaccggtgtgtcgatgcatgccctgggctttcgccagttgaccggcgagcccattggc
ctcgccgcgcgctcgccggagttcggcctgctgttcaacatgggcggcatggcggtggcc
aactacgcctcggtgttgcaggccgtgagggtgtaa

DBGET integrated database retrieval system