KEGG   Pseudomonas protegens CHA0: PFLCHA0_c37240Help
Entry
PFLCHA0_c37240    CDS       T02671                                 

Definition
(GenBank) putative amidase AF
  KO
K02433  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit A [EC:6.3.5.6 6.3.5.7]
Organism
pprc  Pseudomonas protegens CHA0
Pathway
pprc00970  Aminoacyl-tRNA biosynthesis
pprc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pprc00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    PFLCHA0_c37240
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:pprc03029]
    PFLCHA0_c37240
Enzymes [BR:pprc01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     PFLCHA0_c37240
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     PFLCHA0_c37240
Mitochondrial biogenesis [BR:pprc03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    PFLCHA0_c37240
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase
Motif
Other DBs
NCBI-ProteinID: AGL85491
UniProt: A0A2C9EPF3
Position
4188149..4189561
Genome map
AA seq 470 aa AA seqDB search
MKQATDIAALSGVELLRHYRDKRLSPVEVTEDALARIERFNPLVNAYCHIDHQGALDAAR
ASEQRWLKGQPCGALDGLPASIKDLTLTRGMPTRKGSKTTLAAGPWEVDAPFSGFMRAAG
AVLLGKTTTPEFGWKGVTDNPLYGITRNPWDTRLTAGGSSGGAAAAASLNLGVLHQGSDA
GGSIRIPCAFTGTFGIKPTFGYVPQWPASAMNILSHLGPMTRSVDDAVLMLQTVARPDAR
DGLLGAPRSTPWLPENASLKGLRIAYSPDFGYVKVDPQVARVVARAVERLAQLGAQIEQV
DPGFSDPLEMFNTLWFSGAARLTAALSPAQRALLDPGLLRIAEQGEGISLSDYSAALEAR
AALVAHMAAFHERYHLLLSPMLPLTAFAAGHNVPPDSGLGEWMEWTPFSYPFNLTQQPAA
SLPCGFADDGLPVGLHVVGPRFADEQVLRLCRAYEQAFPSPHPQAPVLRH
NT seq 1413 nt NT seq  +upstreamnt  +downstreamnt
atgaagcaagccactgacatcgccgccctgagcggcgtcgaactgctgcgtcattaccgt
gacaagcgcctgtcaccggtggaggtcaccgaggatgccctggcgcgtatcgagcgcttc
aatccgctggtcaacgcctattgccatatcgaccaccaaggggccctggacgcggcacga
gcctccgaacagcgctggctcaagggccagccctgcggcgccctggacggcttgccggcg
tcgatcaaggacctgaccctgacccgtggcatgcccacccgcaagggctcgaaaactacc
ttggccgccggcccctgggaagtcgacgcgcccttctccggcttcatgcgcgcggccggc
gcggtgctgctgggcaagaccaccaccccggaattcggctggaaaggcgtgaccgacaac
cctttgtacggcatcactcgcaacccctgggacactcgcctgacggccggcggttcctcc
ggcggcgcagcggcggctgcctcgctgaacctcggcgtgttgcaccagggcagcgatgcc
ggcggatcgatccgcattccctgcgccttcaccggcaccttcggcatcaagccgaccttc
ggctacgtgccgcagtggccggccagcgcgatgaacattctctcgcacctggggccgatg
acccgcagcgtcgatgacgccgtgctgatgctgcagaccgtggcccgtccggatgcccgt
gacggcctgctcggcgcaccgcgcagcacgccctggttaccggaaaatgccagcctcaag
ggcctgcgcatcgcctacagcccggacttcggctacgtcaaggtcgacccgcaagtggcg
cgagtggtggctcgggcggtggagcgcctggcgcaactgggggcacagatcgagcaggtc
gatcccggtttcagtgatcccctggagatgttcaataccctgtggttctccggggcggcg
cgcctgaccgcagccctcagccccgcccagcgtgccttgctggacccgggcctgctgcgc
atcgccgaacagggcgaaggcatcagcctcagcgactacagcgccgccctggaggcgcgc
gccgccctggtggcccacatggccgccttccatgagcgctaccacctgctgctctcgccg
atgctgcccctgaccgccttcgccgccggacataacgtcccaccggactcgggcctgggg
gagtggatggagtggacgcccttcagctaccccttcaacctgacccagcaaccggcggct
tcactgccctgcggctttgccgacgacggcctgcccgtgggcctgcacgtagtcggccca
cgctttgccgacgagcaagtgctgcgcttgtgccgggcctatgagcaagcgttccccagc
ccccacccccaagcccccgtcctgcgacactga

DBGET integrated database retrieval system