KEGG   Pseudomonas protegens CHA0: PFLCHA0_c41680Help
Entry
PFLCHA0_c41680    CDS       T02671                                 

Definition
(GenBank) ThiJ/PfpI family protein
  KO
K18199  cyclohexyl-isocyanide hydratase [EC:4.2.1.103]
Organism
pprc  Pseudomonas protegens CHA0
Pathway
pprc00930  Caprolactam degradation
Brite
KEGG Orthology (KO) [BR:pprc00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00930 Caprolactam degradation
    PFLCHA0_c41680
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:pprc01002]
    PFLCHA0_c41680
Enzymes [BR:pprc01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.103  cyclohexyl-isocyanide hydratase
     PFLCHA0_c41680
Peptidases [BR:pprc01002]
 Cysteine Peptidases
  Family C56: PfpI endopeptidase family
   PFLCHA0_c41680
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DJ-1_PfpI
Motif
Other DBs
NCBI-ProteinID: AGL85932
UniProt: A0A2C9EQI5
Position
4712021..4712707
Genome map
AA seq 228 aa AA seqDB search
MAVQIGFLLFPEVQQLDLTGPHDVLASLPDVQVHLIWKEPGPVVASSGLVLQATTSFADC
PPLDVICIPGGTGVGALMEDPQALAFIRQQAARARYVTSVCTGSLVLGAAGLLQGKRATT
HWAYHELLAPLGAIPVHERVVRDGNLLTGGGITAGIDFALTLAAELFDAATAQRVQLQLE
YAPAPPFNAGSSDTAPASVVQQARQRAADSLHKRREITLRAAARLAAG
NT seq 687 nt NT seq  +upstreamnt  +downstreamnt
atggcagtgcagataggttttctgttgttccccgaggtccagcaactggatctgaccggt
ccccacgacgtactggcctcgctgccggatgtgcaggtgcacctgatctggaaggagccg
gggccggtggtggccagctcggggctggtgctgcaggccaccacaagcttcgccgactgc
ccgccgctggatgtgatctgcatccccggcggtaccggggtcggggcgctgatggaagac
ccgcaggccctggcgttcatccgccagcaggccgcccgggcgcgctacgtgacctcggtg
tgcaccggctccttggtgctcggcgccgcgggcctgctccagggcaagcgcgccaccacc
cactgggcctaccacgaactgctggcgccgctgggggcgataccggtgcatgagcgggtg
gtgcgtgacggcaacctgctgaccggcggcggtatcaccgccggcatcgacttcgccctg
accctggccgccgaactgttcgacgccgccaccgcgcagcgggtacagctgcaactggag
tacgccccggcgccaccgttcaatgccggcagctcggataccgcccccgccagcgtggtg
cagcaggcccgccagcgcgccgcggactcgctgcacaagcgccgggaaatcaccctgcgc
gcggccgcgcggctggcagccggctga

DBGET integrated database retrieval system