KEGG   Pseudomonas protegens CHA0: PFLCHA0_c46180Help
Entry
PFLCHA0_c46180    CDS       T02671                                 

Gene name
pitA2
Definition
(GenBank) Low-affinity inorganic phosphate transporter 1
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
pprc  Pseudomonas protegens CHA0
Brite
KEGG Orthology (KO) [BR:pprc00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    PFLCHA0_c46180 (pitA2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4 TctB
Motif
Other DBs
NCBI-ProteinID: AGL86369
UniProt: A0A2C9ERZ5
Position
5210562..5212172
Genome map
AA seq 536 aa AA seqDB search
MATPSLTAASSNLDSKPQLDKKPGPFTLVAFFAVLAMGLLFTAYSLVHDMHELGTTVTTW
TPFLLLGVALLIALGFEFVNGFHDTANAVATVIYTHSLPPQFAVVWSGLFNFLGVLLSSG
AVAFGIIALLPVELILQVGSSAGFAMIFALLIAAILWNLGTWWLGLPASSSHTLIGSIIG
VGVANALMHGRDGTSGVDWGQATKVGYALLFSPLIGFVFAALLLLALRLFVKNRALYKAP
KGDAPPPWWIRGLLILTCTGVSFAHGSNDGQKGMGLIMLILVGTLPMAYALNRTMPADQS
LQFAAVAEVTQQALVKSAPQPAPADSRAVLSEYMRSKEATPELIPALAALTGAIGTEVKG
YGSLAKVPAEAMGNVRNDMYLTSEAIRLMDKNQVGHFDQDTRDKLQLFKQQIDNATRFIP
LWVKIAVAIALGLGTMVGWKRIVVTVGEKIGKTHLTYAQGASAETVAMLTIGAADMFGLP
VSTTHVLSSGVAGTMVANGGGLQMRTIRNLAMAWVLTLPAAILLSGSLYWLFTQLF
NT seq 1611 nt NT seq  +upstreamnt  +downstreamnt
atggccaccccgtccctgactgccgcttcgtccaacctcgacagcaaaccgcaactggat
aaaaagcccggccccttcaccctcgtcgccttcttcgcggtgctggccatgggcttgctg
ttcaccgcctacagcctggtgcacgatatgcacgagctgggcaccacggtcaccacctgg
accccgttcctgctcctgggcgtggcgttgctgatcgccctgggcttcgagttcgtcaac
ggtttccatgacaccgccaacgccgtggccacggtgatctacacccactcgctgccgccg
cagttcgcggtggtctggtccggcctgttcaacttcctcggcgtactgctgtccagcggc
gcggtggctttcggcatcatcgccctgctgccggtggaactgatcctgcaggtgggttcc
tccgccggtttcgcgatgatcttcgccctgctgatcgccgccatcctatggaacctcggc
acctggtggctgggcctgccggcttcgtcttcccacaccctgatcggctcgatcatcggt
gtcggcgtggccaatgccctgatgcatggccgcgacggcaccagcggcgtggactggggc
caggccaccaaggtcggctacgccctgctgttctcgcccctgatcggcttcgtgttcgcc
gccctgctgctgttggccctgcgcctgttcgtcaagaaccgtgccctgtacaaggccccc
aagggcgacgcaccgccgccctggtggattcgcgggctgctgatcctgacctgcaccggc
gtgtccttcgcccacggttccaacgacggccagaaaggcatgggcctgatcatgctgatc
ctggtgggcaccctgcccatggcctacgccttgaaccgcaccatgcccgccgaccagtcg
ctgcaattcgccgcggtggccgaagtcacccagcaggccctggtgaagagtgccccgcaa
ccggcgccggccgattcccgcgcggtgctctcggagtacatgcgcagcaaggaagcgaca
ccggaactgatccccgcgctggccgccctgaccggcgccatcggcactgaagtgaagggc
tacggttcgctggccaaggtgcccgccgaagccatgggcaacgtgcgcaacgacatgtac
ctgaccagcgaggcgatccgcctgatggacaagaatcaggtaggccacttcgaccaggac
acccgggacaaactgcaactgttcaagcaacagatcgacaacgccacgcgcttcattccg
ctgtgggtgaagatcgccgtggccatcgcccttggcctgggcaccatggtgggctggaag
cgcatcgtggtcaccgttggcgaaaagatcggcaagacccacctgacctacgcccagggc
gcctcggcggaaaccgtggcgatgctgaccatcggcgcggcggacatgttcggcctgccg
gtgtccaccacccatgtgctgtcctcgggggtggccgggaccatggtggccaatggcggc
ggcttgcagatgcgcaccatccgcaacctggccatggcctgggtgctgaccctgccggcg
gcgatcctgctgtccggcagcctgtactggttgttcactcagctgttctga

DBGET integrated database retrieval system