KEGG   Pseudomonas protegens CHA0: PFLCHA0_c55300Help
Entry
PFLCHA0_c55300    CDS       T02671                                 

Gene name
rplV
Definition
(GenBank) 50S ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
pprc  Pseudomonas protegens CHA0
Pathway
pprc03010  Ribosome
Brite
KEGG Orthology (KO) [BR:pprc00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    PFLCHA0_c55300 (rplV)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:pprc03011]
    PFLCHA0_c55300 (rplV)
Ribosome [BR:pprc03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    PFLCHA0_c55300 (rplV)
  Bacteria
    PFLCHA0_c55300 (rplV)
  Archaea
    PFLCHA0_c55300 (rplV)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22
Motif
Other DBs
NCBI-ProteinID: AGL87268
UniProt: A0A2C9EUV4
Position
complement(6152150..6152485)
Genome map
AA seq 111 aa AA seqDB search
MMEVAAKLSGARISAQKARLVADQIRGKKVGEALNLLAFSSKKAAEIMKKVLESAVANAE
HNEGADVDDLKVSTVFVNEGRSLKRIMPRAKGRADRIVKRSCHITVKVADK
NT seq 336 nt NT seq  +upstreamnt  +downstreamnt
atgatggaagtagccgctaagttgtcgggcgctcgaatctccgcccagaaagcccgcttg
gtcgccgaccagatccgcgggaagaaggtgggcgaagcgctcaacctgttggctttcagc
agtaagaaagccgccgagatcatgaagaaagtgctggagtcggccgtagccaacgccgag
cataacgaaggcgcagacgttgatgacctgaaggtctccaccgttttcgtcaacgaaggg
cgttcgctgaagcgcatcatgccacgtgccaaaggccgtgctgatcgcatcgtcaagcgg
tcttgccatatcactgtcaaggttgctgacaagtaa

DBGET integrated database retrieval system