KEGG   Pseudomonas protegens CHA0: PFLCHA0_c57830Help
Entry
PFLCHA0_c57830    CDS       T02671                                 

Gene name
gshB
Definition
(GenBank) glutathione synthetase GshB
  KO
K01920  glutathione synthase [EC:6.3.2.3]
Organism
pprc  Pseudomonas protegens CHA0
Pathway
pprc00270  Cysteine and methionine metabolism
pprc00480  Glutathione metabolism
pprc01100  Metabolic pathways
Module
pprc_M00118  Glutathione biosynthesis, glutamate => glutathione
Brite
KEGG Orthology (KO) [BR:pprc00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    PFLCHA0_c57830 (gshB)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    PFLCHA0_c57830 (gshB)
Enzymes [BR:pprc01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.3  glutathione synthase
     PFLCHA0_c57830 (gshB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSH-S_ATP GSH-S_N RimK ATPgrasp_YheCD
Motif
Other DBs
NCBI-ProteinID: AGL87511
UniProt: A0A2C9EVB5
Position
6432187..6433140
Genome map
AA seq 317 aa AA seqDB search
MSVRVGIVMDPIASISYKKDSSLAMLLAAQERGWTLFYMEQRDLYQGDGVARARMRPLQV
FANPQKWFELDAEIDCPLSDLDVILMRKDPPFDMEFVYSTYLLEQAESAGVLVVNKPQSL
RDCNEKLFATLFPQCTPPTVVSRRADVLREFAAQHGDVILKPLDGMGGTSIFRHRAGDPN
LSVILETLTVLGSQQIMAQAYLPAIKDGDKRILMIDGEPVDYCLARIPAAGETRGNLAAG
GRGEARPLSDKDRWIAAQVGPTLRAKGLLFVGLDVIGEHLTEINVTSPTCIREIDNAFGT
NIGAMLMDAIDQKLKAK
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
atgagcgttcgcgtcgggattgtcatggaccctatcgccagcatctcctacaagaaggac
agctcgctggccatgctgctggccgcccaggagcgcggctggaccctcttctatatggag
cagcgcgacctgtaccagggcgacggcgtggcccgggcccgcatgcgcccgctgcaggtg
ttcgccaacccgcagaagtggttcgagctggacgccgagatcgactgcccgctgagcgat
ctggacgtgatcctgatgcgcaaggacccgcccttcgacatggagttcgtctactccacc
tacctgctggaacaggccgaaagcgctggcgtgctggtggtcaacaagccccagagcctg
cgtgactgcaacgaaaagctgtttgccacgctgttcccccagtgcaccccgcccaccgtg
gtcagccgccgcgccgacgtgctgcgcgagttcgcggcccagcatggcgatgtgatcctc
aagcccctggatggcatgggcggcacctcgatcttccgccaccgcgcgggtgatccgaac
ctgtcggtgatcctggaaaccctgaccgtgctcggcagccagcagatcatggcccaggcc
tacctgccggcaatcaaggacggtgacaagcgcatcctgatgatcgacggcgaaccggtg
gattactgcctggcgcgcatccccgccgccggtgaaacccgcggcaacctggcggccggc
ggtcgtggcgaagcccgcccgctgagcgacaaggaccgctggatcgccgcccaggtcggc
ccgaccctgcgggccaagggcctgctgttcgtcggcctcgacgtgatcggcgaacacctg
acggaaatcaacgtcaccagccccacctgcatccgtgaaatcgacaacgccttcggcacc
aacatcggcgcgatgctgatggatgccatcgatcagaagctcaaggccaagtga

DBGET integrated database retrieval system