KEGG   Pseudomonas protegens CHA0: PFLCHA0_c60380
Entry
PFLCHA0_c60380    CDS       T02671                                 

Gene name
prpC2
Definition
(GenBank) protein phosphatase PrpC
  KO
K11915  serine/threonine protein phosphatase Stp1 [EC:3.1.3.16]
Organism
pprc  Pseudomonas protegens CHA0
Pathway
pprc02025  Biofilm formation - Pseudomonas aeruginosa
pprc03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:pprc00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    PFLCHA0_c60380 (prpC2)
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02025 Biofilm formation - Pseudomonas aeruginosa
    PFLCHA0_c60380 (prpC2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:pprc02044]
    PFLCHA0_c60380 (prpC2)
Enzymes [BR:pprc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     PFLCHA0_c60380 (prpC2)
Secretion system [BR:pprc02044]
 Type VI secretion system
  Imp/Vas secretion system related proteins
   PFLCHA0_c60380 (prpC2)
SSDB
Motif
Pfam: PP2C_2 PP2C SpoIIE
Other DBs
NCBI-ProteinID: AGL87766
UniProt: A0A2C9EVQ5
Position
complement(6696596..6697330)
AA seq 244 aa
MRSAPQLSYQSASYSHVGMVRKINEDAWLEAPETGLWLVADGMGGHAAGDYVSSLIVDSL
RAVPAADSLDDYVAALRNGLAAVNAAVREETANRGVTMMGSTVVLLAVRGARAVCLWAGD
SRLYRLRDEQLEGISRDHSYVQDLQDSGLLSEAEARVHPRANIVTRAIGVEAQLELSQID
LQVQDGDTFLLCSDGLNKTAEDFELRDVLSHSEPNDVVRSLIHLGLTRGAPDNITAIVIK
AAGH
NT seq 735 nt   +upstreamnt  +downstreamnt
atgcgttcagcgccgcaactgtcctaccagtccgccagctacagccatgtcggcatggtg
cggaaaatcaatgaagacgcctggctcgaagccccggagaccggcctgtggctggtggcc
gacggtatgggcgggcacgccgccggggactatgtcagcagcctgatcgtcgacagcctg
cgggcggttccggccgccgacagcctggacgactatgtcgccgcgctgcgcaacggcctg
gccgcggtcaacgccgcggtgcgcgaggaaaccgccaaccgtggggtgaccatgatgggc
agcactgtggtgctgctggcggtacgcggggcccgggccgtgtgcctgtgggccggcgat
agccgcctgtaccggttgcgggacgaacagctggaaggcatttcccgggaccacagctac
gtccaggacctgcaggacagcggcctgctcagcgaggccgaggcgcgggtgcacccgcgg
gccaacatcgtgacccgggcgattggcgtcgaggcccagctggagctgtcccagattgac
ctgcaggtgcaggacggcgacaccttcctgctgtgcagcgacggcctgaacaagaccgcc
gaggactttgagctgcgtgacgtgctcagccacagcgagcccaatgacgtggtgcgcagc
ctgatccacctgggcctgacccggggcgctccggacaacatcaccgccatcgtgatcaag
gccgcaggacactga

DBGET integrated database retrieval system