KEGG   Pseudomonas protegens CHA0: PFLCHA0_c60390
Entry
PFLCHA0_c60390    CDS       T02671                                 

Definition
(GenBank) hypothetical protein
  KO
K11890  type VI secretion system protein ImpM
Organism
pprc  Pseudomonas protegens CHA0
Pathway
pprc02025  Biofilm formation - Pseudomonas aeruginosa
Brite
KEGG Orthology (KO) [BR:pprc00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02025 Biofilm formation - Pseudomonas aeruginosa
    PFLCHA0_c60390
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:pprc02044]
    PFLCHA0_c60390
Secretion system [BR:pprc02044]
 Type VI secretion system
  Imp/Vas secretion system related proteins
   PFLCHA0_c60390
SSDB
Motif
Pfam: TagF_N
Other DBs
NCBI-ProteinID: AGL87767
UniProt: A0A2C9EVR0
Position
complement(6697331..6697984)
AA seq 217 aa
MTAPGLYGKLASRGDFVSRGLPQSFIGPWDSWLAAGLLASQNALGEQWLNAYLISPLWRF
ALAPGVCGPQAAVGVVMPSIDRVGRYFPLTVAALLEPEADLASLVGGPEQWFEQVEELLL
ATLEEGASFEALEEGLQALGAPSPASRIEGSHYAGLQRFYVSDPQARGAVLAAQACAGSS
AWWGRGSQYISPMLLRCQGLPPASEFAQFLLGQEGAV
NT seq 654 nt   +upstreamnt  +downstreamnt
atgacggcgccgggcctgtacggcaagttggccagccgcggcgattttgtcagccgtggc
ctgccgcagagtttcatcggcccctgggacagttggctggcggcggggctgctggccagc
cagaacgccctgggtgagcagtggctgaacgcctacctgatcagcccgttgtggcgcttc
gccctggcccccggggtctgcgggccccaggcggcggtcggggtggtgatgccgagcatc
gaccgggtggggcgctatttccccctgaccgtggctgcgctgctggagcccgaggctgac
ctggcttcgttggtcggcggcccggagcagtggttcgaacaggtggaagagctgttgctg
gcgaccctggaagagggcgccagtttcgaagccctggaagagggcttgcaggccctgggc
gcgccaagcccggccagccggatcgaaggcagccactacgccggcctgcagcggttttac
gtcagcgatccacaggcccggggcgcggtactcgcggcccaggcctgcgcgggatcgagt
gcctggtgggggcgcggttcgcagtacatcagcccaatgctgttgcgctgccagggcttg
ccgccggccagtgaatttgcgcaatttttgctcggacaagagggtgccgtctaa

DBGET integrated database retrieval system