KEGG   Pseudomonas protegens CHA0: PFLCHA0_c60540
Entry
PFLCHA0_c60540    CDS       T02671                                 

Name
(GenBank) hypothetical protein
Organism
pprc  Pseudomonas protegens CHA0
SSDB
Motif
Pfam: DcrB YlqD
Other DBs
NCBI-ProteinID: AGL87782
UniProt: A0A2C9EVT3
Position
6718650..6719075
AA seq 141 aa
MTYRLNELQFQLPAGELQDASINILKFPALGTSLIVSRSLLGDGETLESNLASQLQRLEQ
QVQDLRCQAPQPVQLGPAQDIQGLELRSQFNKGKEQVFQFQLALVLPGTRQMLAMSYVKA
QKLGDAEAAHWAQIKNTLVLG
NT seq 426 nt   +upstreamnt  +downstreamnt
atgacctatcgcctcaatgaattgcagttccagctgcctgccggcgaactgcaggacgcc
tcgatcaatatcctcaagttcccggccctgggcacttcgctgatcgtcagccgcagcctg
ctgggggacggcgaaaccctggagagcaacctggccagccagctgcagcggctggagcag
caagtccaggacctgcgctgccaggctccgcaaccggtgcagctgggcccggcccaggac
atccagggcctggagctgcgcagccagttcaacaagggcaaagaacaggtgttccagttc
cagctggccctggtgctgcccggcacccgacagatgctcgccatgagctacgtcaaggca
cagaagctcggcgacgcggaagccgcccattgggcgcagatcaagaacaccctggtgctg
ggctga

DBGET integrated database retrieval system