KEGG   Pseudodesulfovibrio profundus: DPRO_0157Help
Entry
DPRO_0157         CDS       T05258                                 

Definition
(GenBank) Methylenetetrahydrofolate reductase
  KO
K00297  methylenetetrahydrofolate reductase (NADPH) [EC:1.5.1.20]
Organism
pprf  Pseudodesulfovibrio profundus
Pathway
pprf00670  One carbon pool by folate
pprf01100  Metabolic pathways
pprf01120  Microbial metabolism in diverse environments
pprf01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pprf00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    DPRO_0157
Enzymes [BR:pprf01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.20  methylenetetrahydrofolate reductase [NAD(P)H]
     DPRO_0157
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MTHFR
Motif
Other DBs
NCBI-ProteinID: SOB57036
UniProt: A0A2C8F3P6
Position
DPRO:157527..158420
Genome map
AA seq 297 aa AA seqDB search
MRVCDLIDKKSPFISLEFFPPKEKDAWPGFFDVVEKLKELAPLFASVTYGAGGGTQDNTL
EIATRMKRDHGIEPITHLTSVGASAKRLDDFLLKLREANIENVLALRGDPPRGVEDFDFD
KQEFRHATDVIEFISKRYPEMCVGGAAYPEPHFESPSIQSDLEMVNLKVQKGAKFLVTQL
FFDNRLYFDYVERLKQMGSEVPVIPGILPIMSLKSAKFILSLCGAAIPGKFLSALEKAHE
EGGDEAVYSLGMEYAIKQSQELLDGGAPGVHLYTLNRAKACLDIGRNLKIEERLERE
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
ttgcgagtatgtgatcttattgacaaaaaatctccgtttatctccctggagtttttcccg
ccaaaagaaaaggatgcctggccaggctttttcgatgtagtcgaaaagctcaaggaattg
gcccccttgttcgcttccgtgacctatggcgcaggtggcggtacacaggacaataccttg
gaaatcgcaactcgtatgaaacgcgatcatggtattgagcccatcacgcatttgaccagt
gttggtgcatctgccaagcgattggatgattttctgctgaagcttcgcgaggctaatatt
gaaaacgttctggctcttcgtggtgatccgccccgtggtgtcgaggacttcgattttgat
aagcaggagtttcgtcacgcaaccgatgtgatcgagttcatctccaaacgctacccggaa
atgtgtgttggcggagctgcttatcctgaaccgcactttgagtcaccctccattcagtct
gatctggaaatggtcaatctcaaggttcaaaagggcgcgaaatttctggtaacgcagttg
tttttcgacaaccgcctttactttgactacgttgagagactcaagcagatgggttcagaa
gtgcctgttattcctggcatcctgcctattatgagcttgaagtccgctaaatttattctc
agcctttgcggtgctgccatccccgggaaattcctgagcgcattggaaaaagcacatgaa
gaaggcggcgatgaagccgtgtacagccttggcatggagtacgccatcaaacagtctcaa
gagcttcttgatggcggtgccccaggtgttcacctttatacgttgaaccgcgccaaggca
tgtctcgatattggcaggaatttgaagatagaagagagattggagagagagtaa

DBGET integrated database retrieval system