KEGG   Pseudodesulfovibrio profundus: DPRO_2925Help
Entry
DPRO_2925         CDS       T05258                                 

Definition
(GenBank) Threonine aldolase
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
pprf  Pseudodesulfovibrio profundus
Pathway
pprf00260  Glycine, serine and threonine metabolism
pprf01100  Metabolic pathways
pprf01110  Biosynthesis of secondary metabolites
pprf01120  Microbial metabolism in diverse environments
pprf01130  Biosynthesis of antibiotics
pprf01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:pprf00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    DPRO_2925
Enzymes [BR:pprf01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     DPRO_2925
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase Aminotran_5 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: SOB59835
UniProt: A0A2C8FBM1
Position
DPRO:3001880..3002920
Genome map
AA seq 346 aa AA seqDB search
MSDLKSFASDNNSGAHPAIMEAVVNCNVGHLKSYGEDEISIRTDRVFEEFFGSQARIHYV
TTGTAANVLGIRAVTHTYNSVICAEQAHINNDECGAPEAFGGIKLVPVPSKDGKLTPGSI
APYLGHVGFVHASQPKVISITQPTEVGKLYTLKEIEELVEFAHDRDLLVHLDGARIANAC
AALDCSFFDMTTALGVDLISFGGTKNGCLMGEAVVFLNPDIGEGFVYLRKQAMQLVSKMR
FVSAQLNRYLADDLWLTNARQANAMAQRLAEKAGAIEGVTIKGTVDCNAIFAHIPPEATE
ILLEKYYFYVWDEHDHTVRWMTSWATTEEMVDEFVADIEKAVAAVR
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atgtctgatttgaaatcctttgccagcgacaataattccggcgcacatccggccatcatg
gaggccgtggtcaactgcaacgtgggacacctcaagtcctacggtgaagacgaaatctcc
atccgcaccgacagagtgttcgaggagttcttcggatcccaggcgcgcatccactatgtg
accaccggtaccgcggccaacgtgcttggcatccgggctgtcacccacacctacaactcc
gtcatctgcgcggagcaggcccatatcaataatgatgaatgcggcgcgcccgaggcgttt
ggcggcatcaagctggtgcccgttccttccaaagacggtaagctgacccctggctccatt
gccccgtatctcggccatgtgggattcgtgcacgcgtcccagcccaaggtcatctccatc
acccagcccacggaagtcggcaagctctatacgctcaaagagatcgaggaactggtcgaa
tttgcccatgaccgcgatctgctcgtccatttggatggtgcgcgtatcgccaatgcctgc
gctgcccttgattgctcgttttttgatatgaccactgcgctcggcgttgacctgatctcg
ttcggcggcaccaagaacggctgcctcatgggcgaggccgtggtgttcctgaaccccgac
atcggcgaagggttcgtctacctgcgcaagcaggccatgcagttggtttcgaagatgcgc
tttgtctctgcccagctcaaccgctaccttgccgatgacctgtggctgaccaacgcacgt
caggccaatgccatggcacagcgtctggctgaaaaggccggagccatcgaaggcgtcacc
atcaaagggaccgtggattgcaacgcgattttcgcgcacatcccacccgaggccacggag
attctgctggagaagtactacttttatgtatgggacgagcacgaccacacggtccgctgg
atgacctcctgggccaccaccgaagagatggtcgacgagtttgttgccgacatcgaaaaa
gctgtggctgcggttcggtaa

DBGET integrated database retrieval system