KEGG   Pseudodesulfovibrio profundus: DPRO_3889Help
Entry
DPRO_3889         CDS       T05258                                 

Gene name
coaE
Definition
(GenBank) Dephospho-CoA kinase
  KO
K06180  23S rRNA pseudouridine1911/1915/1917 synthase [EC:5.4.99.23]
Organism
pprf  Pseudodesulfovibrio profundus
Brite
KEGG Orthology (KO) [BR:pprf00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:pprf03009]
    DPRO_3889 (coaE)
Enzymes [BR:pprf01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.23  23S rRNA pseudouridine1911/1915/1917 synthase
     DPRO_3889 (coaE)
Ribosome biogenesis [BR:pprf03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    DPRO_3889 (coaE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PseudoU_synth_2 CoaE S4 MMR_HSR1 MeaB AAA_22 AAA_16 ABC_tran AAA_18 AAA_33 NB-ARC AAA_28 AAA_17 G-alpha ATP_bind_1 RsgA_GTPase cobW Viral_helicase1
Motif
Other DBs
NCBI-ProteinID: SOB60808
UniProt: A0A2C8FEC2
Position
DPRO:4041270..4042940
Genome map
AA seq 556 aa AA seqDB search
MDNKNTGRWERTVSAQDIGTRLDKFWARELAETGVSRGKVKSWIESGLATVNGEVVDKGK
YKLAGFDTLEIGELQSSGEDTAEAIPGDLKIVYEDDNIVVVDKAAGVTTHPAPGEPDATL
VNYLLHSYPDMASAESGMDGQRPGIVHRLDKDTSGLIVVARNEAGRLRLSADFAERSVDK
VYLAVVHGRPKKAEGGIDAPIGRHPTRKTRMAVVEKGGREARSDYRVLWTGPRGLASLVA
VRIHTGRTHQIRVHMAHIGHPLVGDATYGSQEDAVWKRRDDKLAQLGPRQMLHAFHISFT
HPQTKERLTFWQTPPEDILSLLQGLYRECLRVGIVGMPGSGKSTVVNSLRKQAHPTFSAD
ESVAKLYEAGGDGADMIAQRFGNQFSHEDGSVDKAKLFSAMCDSENLRREVMDMVHPMVR
HECELFFRAHRDTSVAYAEVPLLLEGGWHKTGQVDVVAGVRCPEEMRTGDLRRQRGLSRE
MLAVFDSWQWPEQDKLAACDMVVENSGSLEDLEQETRRLHEWATARFTERNAEFAKWLDE
LWPRLAQEFAGEGDKA
NT seq 1671 nt NT seq  +upstreamnt  +downstreamnt
atggataataaaaacacaggcagatgggaacgaaccgtttccgcacaggatattggtacg
cggctcgacaagttttgggcacgtgaactggcggagacaggcgtttccagaggcaaagtc
aaaagctggattgaatcagggctggccacggtcaatggtgaagtcgttgacaagggcaaa
tataaactggccgggttcgacacgcttgagatcggtgagctgcagtcttcaggagaagat
actgcagaagccatccccggtgatctgaagatagtatatgaagatgacaatatagtggtt
gtggataaagccgccggtgtcaccacgcatcccgcaccgggtgaaccggatgcaacactg
gtcaattatctgcttcacagttacccggatatggcgtcggcagaatccggcatggatggt
cagcgcccgggaatagtgcatcgactggacaaggatacatcgggtctcattgtcgtggcg
cgaaacgaagctggccgccttcgactgtctgcagattttgcagagcggagtgtggacaag
gtctacttggccgtggttcatggccgtcccaagaaagccgaagggggtattgatgctccc
atcgggcggcaccccactcgcaagacccgtatggccgtggtcgaaaaagggggccgagag
gcgcgtagcgattatcgcgtcctctggaccggaccgcgagggctggcaagtctggtcgca
gtccgaattcatacgggcagaactcatcagattcgtgtgcatatggctcatatcggacac
cctctggtgggagatgccacctatggttcacaggaagatgcggtctggaagcgacgcgac
gacaaactggctcaactcgggccacgacaaatgctccatgcatttcatatttctttcacc
catccacagacgaaagaacggctgaccttctggcaaacaccgcctgaagatattctgtcg
ctcctccaggggctgtatcgtgaatgcctccgtgtggggattgtcgggatgccgggttca
ggaaagtcgacggtggtcaattctctgcggaaacaagcgcatccgacattcagcgccgat
gaatccgtggcgaaactctacgaagccggaggcgatggggctgacatgattgcccagcgc
tttggcaaccagttcagccacgaagacggcagcgttgacaaggcaaagctcttttcggcc
atgtgtgattctgagaatctgcgtcgggaagtcatggacatggtccatcccatggttcga
catgagtgcgaactgttcttccgggcgcaccgtgacacttcggtagcgtatgccgaagtg
cctttgctactggaaggggggtggcacaagaccggccaggtcgatgtggttgcaggtgtt
cgttgcccagaggaaatgcgtacaggcgacctgcggcgtcaacgaggtctgtcgcgtgaa
atgctggccgtattcgattcatggcagtggcccgagcaggataagctcgcggcatgtgat
atggtcgtggaaaatagcggctcactggaagaccttgaacaggaaacgcgccgtttgcac
gagtgggcgacagcacgctttaccgagcgcaatgccgaatttgccaagtggctcgatgaa
ctgtggcctcggttggcccaggaatttgcaggggagggagacaaggcatga

DBGET integrated database retrieval system