KEGG   Pseudomonas protegens Cab57: PPC_1319Help
Entry
PPC_1319          CDS       T03613                                 

Gene name
hisQ
Definition
(GenBank) histidine ABC transporter permease HisQ
  KO
K10016  histidine transport system permease protein
Organism
ppro  Pseudomonas protegens Cab57
Pathway
ppro02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:ppro00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    PPC_1319 (hisQ)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ppro02000]
    PPC_1319 (hisQ)
Transporters [BR:ppro02000]
 ABC transporters, prokaryotic type
  Phosphate and amino acid transporters
   Lysine/arginine/ornithine transporter
    PPC_1319 (hisQ)
   Histidine transporter
    PPC_1319 (hisQ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPD_transp_1 Holin_9 BofA
Motif
Other DBs
NCBI-ProteinID: BAO60666
Position
complement(1464150..1464878)
Genome map
AA seq 242 aa AA seqDB search
MLEELLKNLGLSALSLKGFGPLLLEGTWMTIKLSVLSLLVSVLLGLIGASAKLSSVALLR
VPAQLYTTLIRGVPDLVLMLLIFYSLQTWLTSFTDFMEWDYIEINPFSAGVITLGFIYGA
YFTETFRGAILAVPRGQVEAATAYGLKRGQRFRFVVFPQMMRFALPGIGNNWMVMLKATA
LVSIIGLADLVKAAQDAGKSTYQLFYFLVLAALIYLLITSASNFVLRRLERRYAAGAREA
VR
NT seq 729 nt NT seq  +upstreamnt  +downstreamnt
atgctcgaagaacttctaaaaaacctggggctttccgcgctcagcctgaagggtttcggc
cctctgctgctggaaggtacctggatgaccatcaagttgtcggtgttgtcgctgctggtc
agcgttttactgggcctgatcggcgccagcgccaaattgtccagcgttgccctgctgcgg
gttccggcccagctctacaccaccctgatccgcggcgtgccggacctggtcctgatgctg
ctgattttctacagcctgcaaacctggttgacctcctttaccgatttcatggagtgggac
tacatcgagatcaaccccttcagcgccggggtgatcaccctgggtttcatctatggcgcc
tacttcaccgaaacctttcgcggggcgatccttgccgtgccccggggccaggtggaagcc
gccaccgcctatggcctgaaacgcggccagcgctttcgcttcgtggtctttccgcaaatg
atgcgctttgccctgccgggcatcggcaacaactggatggtgatgctcaaggccacggcc
ctggtgtcgatcattggcctggccgacctggtcaaggctgcccaggacgccggcaagagc
acctaccaactcttctacttcctggttctggcggcgctgatctacctgttgatcaccagt
gcctccaactttgtcctgcgcaggcttgaacggcgttacgccgccggcgcccgggaggcc
gtgcgatga

DBGET integrated database retrieval system