KEGG   Pseudomonas protegens Cab57: PPC_1773Help
Entry
PPC_1773          CDS       T03613                                 

Definition
(GenBank) dihydrolipoamide succinyltransferase
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
ppro  Pseudomonas protegens Cab57
Pathway
ppro00020  Citrate cycle (TCA cycle)
ppro00310  Lysine degradation
ppro00380  Tryptophan metabolism
ppro01100  Metabolic pathways
ppro01110  Biosynthesis of secondary metabolites
ppro01120  Microbial metabolism in diverse environments
ppro01130  Biosynthesis of antibiotics
ppro01200  Carbon metabolism
Module
ppro_M00009  Citrate cycle (TCA cycle, Krebs cycle)
ppro_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:ppro00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    PPC_1773
  09105 Amino acid metabolism
   00310 Lysine degradation
    PPC_1773
   00380 Tryptophan metabolism
    PPC_1773
Enzymes [BR:ppro01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     PPC_1773
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding
Motif
Other DBs
NCBI-ProteinID: BAO61120
Position
1948237..1949466
Genome map
AA seq 409 aa AA seqDB search
MAIEIKAPTFPESVADGTVATWHKQPGDAVKRDELIVDIETDKVVLEVLATADGVLGAIV
KNEGDTVLSDEVLGSIVEGGAAAAAPAPAAAAAPAAAAAAPAAADGEDDPIAAPAARKLA
EENGINIASVAGTGKGGRVTKEDVVAAVAAKKAAPAAAPAKAPAPAAAAPVFAAGDRVEK
RVPMTRLRAKVAERLVEAQSNMAMLTTFNEVDMTEVMALRSKYKDLFEKSHNGVRLGFMS
FFVKAATEALKRFPAVNASIDGSDIVYHGYADIGVAVSSDRGLVVPVLRNAELMSLAEIE
GGIATFGKKARDGKLSMEEMTGGTFTITNGGTFGSMMSTPIVNPPQAAILGMHNILQRPM
AINGQVVIRPMMYLALSYDHRLIDGKEAVTFLVTIKNLLEDPARLLLDI
NT seq 1230 nt NT seq  +upstreamnt  +downstreamnt
atggctatcgagatcaaagcccccactttcccggaatcggttgccgatggcaccgttgcc
acctggcacaagcaaccgggcgacgccgtcaagcgtgacgagctgatcgttgacatcgag
accgacaaggtcgtgctggaagttctggccaccgctgacggcgtgctgggcgctatcgtc
aagaacgaaggcgacaccgttctgtccgacgaagtcctgggctccatcgttgaaggcggc
gctgctgccgctgctcctgctcctgctgccgccgccgctccggccgctgccgctgctgcc
ccggctgctgccgatggcgaagacgatccaatcgctgctcctgccgcgcgcaagctggct
gaagaaaacggtatcaacatcgcttccgttgccggtaccggcaaaggcggccgtgtgacc
aaggaagacgtggttgctgctgttgccgcgaagaaagccgctccggctgccgcgcctgcc
aaggctccggctcctgccgctgctgctccggtcttcgctgccggtgatcgcgtcgagaag
cgcgtgcctatgacccgcctgcgtgccaaggttgccgagcgtctggttgaagcccagtcg
aacatggcgatgctgaccaccttcaacgaagtcgacatgactgaagtcatggccctgcgt
tcgaagtacaaggatctgttcgagaagtcccacaatggcgtacgcctgggcttcatgtcg
ttcttcgtcaaggccgccaccgaagccctgaagcgcttcccggctgtcaacgcctcgatc
gacggttccgacatcgtctaccacggttatgccgatatcggtgttgcggtctccagcgac
cgtggcctggtggttccggttctgcgtaacgccgaactgatgagcctggccgaaatcgaa
ggcggcatcgccaccttcggcaagaaggcccgtgacggcaagctgtcgatggaagagatg
accggtggtactttcaccatcaccaacggtggtactttcggttcgatgatgtcgaccccg
atcgtcaacccgccacaagccgcgatcctgggcatgcacaacattctgcagcgtcctatg
gcgatcaacggtcaagtggtcatccgtccgatgatgtacctggcgctgtcctacgatcac
cgcctgatcgacggtaaagaagccgtgacgttcctggtgaccatcaagaacctgctggaa
gacccggctcgtctgctcctggacatctaa

DBGET integrated database retrieval system