KEGG   Pseudomonas protegens Cab57: PPC_1883Help
Entry
PPC_1883          CDS       T03613                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
ppro  Pseudomonas protegens Cab57
Pathway
ppro00071  Fatty acid degradation
ppro00072  Synthesis and degradation of ketone bodies
ppro00280  Valine, leucine and isoleucine degradation
ppro00310  Lysine degradation
ppro00362  Benzoate degradation
ppro00380  Tryptophan metabolism
ppro00620  Pyruvate metabolism
ppro00630  Glyoxylate and dicarboxylate metabolism
ppro00640  Propanoate metabolism
ppro00650  Butanoate metabolism
ppro00900  Terpenoid backbone biosynthesis
ppro01100  Metabolic pathways
ppro01110  Biosynthesis of secondary metabolites
ppro01120  Microbial metabolism in diverse environments
ppro01130  Biosynthesis of antibiotics
ppro01200  Carbon metabolism
ppro01212  Fatty acid metabolism
ppro02020  Two-component system
Brite
KEGG Orthology (KO) [BR:ppro00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    PPC_1883
   00630 Glyoxylate and dicarboxylate metabolism
    PPC_1883
   00640 Propanoate metabolism
    PPC_1883
   00650 Butanoate metabolism
    PPC_1883
  09103 Lipid metabolism
   00071 Fatty acid degradation
    PPC_1883
   00072 Synthesis and degradation of ketone bodies
    PPC_1883
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    PPC_1883
   00310 Lysine degradation
    PPC_1883
   00380 Tryptophan metabolism
    PPC_1883
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    PPC_1883
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    PPC_1883
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    PPC_1883
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ppro04147]
    PPC_1883
Enzymes [BR:ppro01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     PPC_1883
Exosome [BR:ppro04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   PPC_1883
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_C Thiolase_N ketoacyl-synt ACP_syn_III_C
Motif
Other DBs
NCBI-ProteinID: BAO61230
Position
2058343..2059548
Genome map
AA seq 401 aa AA seqDB search
MTQALIFDALRTPRGKGKADGALHSVKPVNLTAGLLRALQQRCELDTSQVDDVVLGCVTP
IGDQGADIAKTAVQAADWDVSVAGVQINRFCASGLEAVNLGAMKVRSGFEELVVVGGVES
MSRVPMGSDGGAWVLDPETNLHSHFTPQGIGADLIATLEGFSREDVDRFALHSQQKAARA
RAGGAFAKSLVPVQDQNGIVLLDHDEFIRADSTLEGLGKLKPSFEMMGQMGFDATALRVY
SHVERIDHVHTPGNSSGIVDGAALMLIGSEAKGRELGLKPRARIVATAVTSTDPTIMLTG
PAPATRKALAKAGLRVEDIDLFEVNEAFASVVLKFIKDMAIDPAKVNVNGGSIAMGHPLG
ATGCAILGTLLDELETRRQRYGLATLCVGGGMGIATIIERL
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atgacccaagctttgatattcgatgcgttacgcacgccccgtggcaaaggcaaggccgat
ggcgccttgcacagcgtgaaaccggtgaacctgaccgcgggcctgttgcgggccctgcag
cagcgctgcgagctggacactagccaggtggacgacgtggtcctgggctgtgtgacgccc
atcggtgatcagggcgccgatatcgccaagaccgcggtccaggctgcggattgggacgta
agcgtggccggggtgcagatcaatcgcttctgcgcttccgggttggaagcggtcaacctg
ggggcgatgaaggtgcgttccgggttcgaggaactggtggtggttggcggcgtcgagtcc
atgtcgcgggtgcccatgggcagcgacggcggggcctgggtgctggacccggagaccaac
ctgcacagccatttcaccccccaggggattggcgccgacctgatcgcgaccctggaaggc
ttctcccgggaggacgtcgaccgctttgccctgcactcccagcagaaggccgcccgcgcc
cgggctggcggggcctttgccaaatccctggtgccggtgcaggaccagaacggcatcgtg
ctgctggaccatgacgagttcattcgcgccgattcgaccctggagggcctgggcaagctc
aagccgagtttcgagatgatggggcagatgggcttcgatgccacggcgctacgggtctac
agccatgtggagcggatcgaccatgtgcacacccccggcaacagctcgggcatcgtcgac
ggcgcggcgctgatgctgatcggctccgaagccaagggccgcgagctggggctcaagccc
cgggcgcggatcgtggccacggcggtcaccagcaccgaccccaccatcatgctcaccggc
ccggcgccggccacccgcaaggccctggccaaggccgggctgcgggtcgaggacatcgac
ctgttcgaagtcaatgaagccttcgcctcggtggtgctcaagttcatcaaggacatggcc
atcgacccggccaaggtcaatgtcaacggcggctccatcgccatgggccacccgctgggg
gccaccggctgcgcgatcctcggcaccttgctcgatgagctggaaacccggcgccagcgc
tatggcctggcgaccctctgtgtcggcggcggcatgggtatcgccaccatcatcgaacgc
ctctga

DBGET integrated database retrieval system