KEGG   Pseudomonas protegens Cab57: PPC_2193Help
Entry
PPC_2193          CDS       T03613                                 

Definition
(GenBank) (R,R)-butanediol dehydrogenase
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
ppro  Pseudomonas protegens Cab57
Pathway
ppro00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:ppro00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    PPC_2193
Enzymes [BR:ppro01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     PPC_2193
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     PPC_2193
    1.1.1.-  
     PPC_2193
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_N_assoc ADH_zinc_N_2 AlaDh_PNT_C 2-Hacid_dh_C UDPG_MGDP_dh_N DAO
Motif
Other DBs
NCBI-ProteinID: BAO61540
Position
2440214..2441317
Genome map
AA seq 367 aa AA seqDB search
MSVSLKPVPSMRAAVWHGRHDIRVEDVPLPDAPPAGWVQIRVDWCGICGSDLHEYVAGPV
FIPVNAPHPLTGIKGQCILGHEFCGEIVALGEGVQGFSVGQPVAADACQHCGTCYYCTHG
LYNICENLAFTGLMNNGAFAELVNVPANLLYALPANFPAEAGALIEPLAVGMHAVKKAGS
LLGQNVVVVGAGTIGLCTIMCAKAAGAAQVIALEMSGARKAKALEVGATHVLDPKECDAL
AEVKRLTGGLGADVSFECIGNKHTAKLAIDLIRKAGKCVLVGIFEEPSEFNFFELVATEK
TVLGALAYNGEFADVIAFIADGRLDIAPLVTGRIQLEEIVGQGFEELVNNKEHNVKIIVS
PGQLRRS
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atgagtgtttccctcaagcctgttcccagcatgcgtgccgcggtctggcacggccgccac
gatatccgcgtcgaagacgtaccgctgcccgacgcgccgcctgccggctgggtgcagatc
cgtgtcgactggtgcgggatctgcggctccgacctgcacgaatacgtggccgggccggtg
ttcattccggtgaacgcaccgcacccgctgaccggaatcaagggccagtgcatcctcggc
cacgagttctgcggcgaaatcgtcgccctgggcgaaggggtccagggtttcagcgttggc
cagccggtggccgccgacgcctgccagcactgcggcacctgttactactgcacccacggg
ctgtacaacatctgcgaaaacctggcctttaccgggctgatgaacaacggcgccttcgcc
gaattggtcaacgtgccggccaacctgctgtacgccttgccggccaactttcccgccgag
gccggagcactgatcgagccgctggcggtgggcatgcacgcggtgaaaaaggccggcagc
ctgctggggcagaacgtggtggtggtcggcgccggcaccatcggcctgtgcaccatcatg
tgcgccaaggccgccggcgcggcccaggtgatcgccctggaaatgtccggcgcgcgcaag
gccaaggccctggaggtgggcgcgacccacgtgctcgaccccaaggagtgcgacgccctg
gccgaggtcaagcgcctgaccggcggattgggcgctgatgtcagctttgaatgcatcggc
aacaagcacaccgccaagctggccatcgacctgatccgcaaggccggcaaatgcgtgctg
gtggggatcttcgaagagcccagcgagttcaacttcttcgagctggtggccaccgagaaa
acggtgctgggggccctggcctacaacggtgagttcgccgatgtgatcgccttcatcgcc
gatggccggctggacattgcgccgctggtgaccgggcgcatccagctggaagagattgtc
ggtcagggcttcgaggagctggtcaacaacaaggaacacaacgtcaagatcattgtttct
cccggtcagttgcgacgctcgtaa

DBGET integrated database retrieval system