KEGG   Pseudomonas protegens Cab57: PPC_4527Help
Entry
PPC_4527          CDS       T03613                                 

Definition
(GenBank) glutathione peroxidase
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
ppro  Pseudomonas protegens Cab57
Pathway
ppro00480  Glutathione metabolism
ppro00590  Arachidonic acid metabolism
ppro01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ppro00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    PPC_4527
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    PPC_4527
Enzymes [BR:ppro01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     PPC_4527
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx AhpC-TSA Redoxin
Motif
Other DBs
NCBI-ProteinID: BAO63874
Position
complement(5062848..5063306)
Genome map
AA seq 152 aa AA seqDB search
MPKLHAKESIDLCQRFAGKPLVVVNTASFCGFAPQFKGLEALYQRYKDQGLEVVGVPSND
FKQESKDGAETAKVCYVNYGVTFTMTEPQKVRGADAVHLFKVLAQQSSAPKWNFYKYVVD
RQGNVIANFSSLTKPDNPEFIEAVEKALASKS
NT seq 459 nt NT seq  +upstreamnt  +downstreamnt
ttgcccaaattgcacgccaaggaatccatcgacctgtgccagcgctttgccggtaagccg
ctggtggtggtcaatacggcgagcttctgcgggtttgctccgcaattcaaaggcctcgag
gcgctgtaccagcgttacaaggatcaagggctggaagtggtgggcgtgccctccaatgac
ttcaagcaagagtccaaggatggcgcggagactgccaaggtctgctacgtcaattacggc
gtgaccttcaccatgaccgagccgcagaaggttcggggggcggatgcggtgcacctattc
aaggtgctggcgcagcagagtagcgcgccgaagtggaatttctataaatacgtggtggat
cgccagggcaatgtgattgccaacttttccagcctgaccaagccggacaatccggaattc
atcgaagcggtggagaaggcattggcgtcgaaatcctga

DBGET integrated database retrieval system