KEGG   Pseudomonas protegens Cab57: PPC_4650Help
Entry
PPC_4650          CDS       T03613                                 

Definition
(GenBank) phosphate transporter
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
ppro  Pseudomonas protegens Cab57
Brite
KEGG Orthology (KO) [BR:ppro00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    PPC_4650
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4 TctB
Motif
Other DBs
NCBI-ProteinID: BAO63997
Position
5191856..5193466
Genome map
AA seq 536 aa AA seqDB search
MATPSLTAASSNLDSKPQLDKKPGPFTLVAFFAVLAMGLLFTAYSLVHDMHELGTTVTTW
TPFLLLGVALLIALGFEFVNGFHDTANAVATVIYTHSLPPQFAVVWSGLFNFLGVLLSSG
AVAFGIIALLPVELILQVGSSAGFAMIFALLIAAILWNLGTWWLGLPASSSHTLIGSIIG
VGVANALMHGRDGTSGVDWGQATKVGYALLFSPLIGFVFAALLLLALRLFVKNRALYKAP
KGDAPPPWWIRGLLILTCTGVSFAHGSNDGQKGMGLIMLILVGTLPMAYALNRTMPADQS
LQFAAVAEVTQQALVKSAPQPAPADSRAVLSEYMRSKEATPELIPALAALTGAIGTEVKG
YGSLAKVPAEAMGNVRNDMYLTSEAIRLMDKNQVGHFDQDTRDKLQLFKQQIDNATRFIP
LWVKIAVAIALGLGTMVGWKRIVVTVGEKIGKTHLTYAQGASAETVAMLTIGAADMFGLP
VSTTHVLSSGVAGTMVANGGGLQMRTIRNLAMAWVLTLPAAILLSGSLYWLFTQLF
NT seq 1611 nt NT seq  +upstreamnt  +downstreamnt
atggccaccccgtccctgactgccgcttcgtccaacctcgacagcaaaccgcaactggat
aaaaagcccggccccttcaccctcgtcgccttcttcgcggtgctggccatgggcttgttg
ttcaccgcctacagcctggtgcacgacatgcacgagctgggcaccacggtcaccacctgg
accccgttcctgctcctgggcgtggcgttgctgatcgccctgggcttcgagttcgtcaac
ggtttccatgacaccgccaacgccgtggccacggtaatctatacccactcgctgccgccg
cagttcgcggtggtctggtccggcctgttcaacttcctcggcgtactgctgtccagcggc
gcggtggctttcggcatcatcgccctgctgccggtggaactgatcctgcaggtgggttcc
tccgccggtttcgcgatgatcttcgccctgctgatcgccgccatcctatggaacctcggc
acctggtggctgggcctgccggcttcgtcttcccacaccctgatcggctcgatcatcggt
gtcggcgtggccaatgccctgatgcatggtcgcgacggcaccagcggcgtggactggggc
caggccaccaaggtcggctacgccctgctgttctcgcccctgatcggcttcgtgttcgcc
gccctactgctgttggccctgcgcctgttcgtcaagaaccgtgccctgtacaaggcaccc
aagggcgacgcaccgccgccctggtggattcgcgggctgctgatcctgacctgcaccggc
gtgtccttcgcccacggttccaacgacggccagaaaggcatgggcctgatcatgctgatc
ctggtgggcaccctgcccatggcttacgccttgaaccgcaccatgcctgccgaccagtcg
ctgcaattcgccgcggtggccgaagtcacccaacaggccctggtgaagagtgccccgcaa
ccggcgccggccgattcccgcgcggtgctctcggagtacatgcgcagcaaggaagcgaca
ccggaactgatccccgcgctggccgccctgaccggcgccatcggcactgaagtgaagggc
tacggttcgctggccaaggtgcccgccgaagccatgggcaacgtgcgcaacgacatgtac
ctgaccagcgaggcgatccgcctgatggacaagaatcaggtaggccacttcgaccaggac
acccgggacaaactgcaactgttcaagcaacagatcgacaacgccacgcgcttcattccg
ctgtgggtgaagatcgccgtggccatcgcccttggcctgggcaccatggtgggctggaag
cgcatcgtggtcaccgttggcgaaaagatcggcaagacccacctgacctacgcccagggc
gcctcggcggaaaccgtggcgatgctgaccatcggcgcggcggacatgttcggcctgccg
gtgtccaccacccatgtgctgtcctcgggggtggccgggaccatggtggccaatggcggc
ggcttgcagatgcgcaccatccgcaacctggccatggcctgggtgctgaccctgccggcg
gcgatcctgctgtccggcagcctgtactggttgttcactcagctcttctga

DBGET integrated database retrieval system