KEGG   Pseudomonas protegens Cab57: PPC_4745Help
Entry
PPC_4745          CDS       T03613                                 

Definition
(GenBank) glycine cleavage system T protein
  KO
K00605  aminomethyltransferase [EC:2.1.2.10]
Organism
ppro  Pseudomonas protegens Cab57
Pathway
ppro00260  Glycine, serine and threonine metabolism
ppro00630  Glyoxylate and dicarboxylate metabolism
ppro00670  One carbon pool by folate
ppro01100  Metabolic pathways
ppro01110  Biosynthesis of secondary metabolites
ppro01130  Biosynthesis of antibiotics
ppro01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ppro00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    PPC_4745
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    PPC_4745
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    PPC_4745
Enzymes [BR:ppro01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.2  Hydroxymethyl-, formyl- and related transferases
    2.1.2.10  aminomethyltransferase
     PPC_4745
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GCV_T GCV_T_C DUF3659
Motif
Other DBs
NCBI-ProteinID: BAO64092
Position
5291362..5292486
Genome map
AA seq 374 aa AA seqDB search
MSTETLLKTPLHSLHLELGARMVPFAGYDMPVQYPLGVMKEHQHTREQAGLFDVSHMGQI
LLRGANAAQALETLVPVDIIDLPVGMQRYAMFTNEQGGILDDLMVANLGDEQLFLVVNAA
CKDQDLAHLRRHLGEQCDIQPLFEERALLALQGPAAVTVLARLAPEVAQMTFMQFKPVTL
LGVDCFVSRSGYTGEDGFEISVPAAQAEKLARALLAEPEVAAIGLGARDSLRLEAGLCLY
GHDMNSDTTPIQASLLWAISKARRADGARAGGFPGAEVIFAQQQGGVSRKRVGLLPQERT
PVREGAEIVDAEGKVIGSVCSGGFGPTLGGPLAMGYLDIEHCALDTPVAAIVRGKKVPML
VSKMPFLPQRYYRG
NT seq 1125 nt NT seq  +upstreamnt  +downstreamnt
atgtccaccgaaacactgttgaaaaccccgctgcacagcctgcacctggaactcggcgcc
cgcatggtgccgttcgccggctacgacatgccggtgcagtacccgctgggagtgatgaag
gagcaccagcacacccgtgaacaggccgggctgttcgatgtgtcccacatggggcagatc
ctgctgcgcggcgccaatgccgcccaggccctggagaccctggtgccggtggatatcatc
gacttgccggtgggcatgcagcgctacgccatgttcaccaacgaacagggcggcatcctt
gatgacctgatggtggccaacctgggggacgaacagctgttcctggtagtcaacgccgcc
tgcaaggaccaggacctggcccacctgcgccgccacctgggcgagcaatgcgacattcaa
ccgctgttcgaggaacgggccctgctggccctgcaaggcccggctgcggtcacggtgctg
gcgcgcctggcgccggaggtggcgcagatgaccttcatgcagttcaagccggtgaccctg
ctgggcgtggactgctttgtcagccgttcgggctacaccggcgaagacggtttcgaaatc
tcggtgccggcggcccaggcggaaaaactcgcccgtgccctgctggccgagccggaagta
gcggccatcggcctcggcgcccgcgactccctgcgcctggaagccggcctgtgcctctat
ggccatgacatgaacagcgacaccacgccgatccaggccagcctgctgtgggccatctcc
aaggcacgtcgtgccgatggcgcccgcgccggcggcttccccggtgccgaggtgatcttt
gcccaacagcaaggcggtgtcagccgcaaacgcgtcggcctgctgccccaggaacgcaca
ccggtacgtgaaggtgcagagatcgtcgacgccgaaggcaaggttatcggcagcgtgtgc
agcggcggttttggtccgaccctgggcggccccttagccatgggctacctcgacatagag
cactgcgcactcgatacgccagttgcagcaatagttcgtgggaaaaaggtgccaatgctt
gtaagcaaaatgccattcctgccacaacgctactaccgcggctga

DBGET integrated database retrieval system