KEGG   Pseudomonas protegens Cab57: PPC_5727Help
Entry
PPC_5727          CDS       T03613                                 

Definition
(GenBank) fructose-1,6-bisphosphate aldolase
  KO
K01624  fructose-bisphosphate aldolase, class II [EC:4.1.2.13]
Organism
ppro  Pseudomonas protegens Cab57
Pathway
ppro00010  Glycolysis / Gluconeogenesis
ppro00030  Pentose phosphate pathway
ppro00051  Fructose and mannose metabolism
ppro00680  Methane metabolism
ppro01100  Metabolic pathways
ppro01110  Biosynthesis of secondary metabolites
ppro01120  Microbial metabolism in diverse environments
ppro01130  Biosynthesis of antibiotics
ppro01200  Carbon metabolism
ppro01230  Biosynthesis of amino acids
Module
ppro_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:ppro00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PPC_5727
   00030 Pentose phosphate pathway
    PPC_5727
   00051 Fructose and mannose metabolism
    PPC_5727
  09102 Energy metabolism
   00680 Methane metabolism
    PPC_5727
Enzymes [BR:ppro01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     PPC_5727
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: F_bP_aldolase DUF285
Motif
Other DBs
NCBI-ProteinID: BAO65074
Position
complement(6343337..6344401)
Genome map
AA seq 354 aa AA seqDB search
MALISMRQMLDHAAEFGYGVPAFNVNNLEQMRAIMEAADKTDSPVIVQASAGARKYAGAP
FLRHLILAAIEEFPHIPVCMHQDHGTSPDVCQRSIQLGFSSVMMDGSLGEDGKTPTDYEY
NVRVTQQTVAMAHACGVSVEGELGCLGSLETGMAGEEDGIGAEGVLDHSQMLTDPEEAAD
FVKKTQVDALAIAIGTSHGAYKFTKPPTGDVLAIDRIKEIHKRIPNTHLVMHGSSSVPQE
WLAIINQYGGDIKETYGVPVEEIVEGIKYGVRKVNIDTDLRLASTGAMRRLMATNPSEFD
PRKFFGATVTAMRDVCIARYEAFGTAGNASKIKPISLEAMFQRYLKGELNAKVN
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atggcactcatcagcatgcgccagatgctggaccacgcagccgagttcggctacggcgtt
ccagctttcaacgtcaacaaccttgagcagatgcgcgccatcatggaagccgctgacaag
actgactccccggtgatcgtccaggcttcggccggcgcccgcaaatacgccggcgcgcct
ttcctgcgtcacctgattctggctgccatcgaagagtttccgcatatcccggtgtgcatg
caccaggaccacggcaccagccctgacgtctgccagcgctccatccaactgggcttttcc
tcggtgatgatggacggctccctcggtgaagacggcaagaccccgaccgactacgaatac
aacgtccgtgttacccagcaaaccgtagccatggctcacgcctgcggcgtgtcggtagaa
ggcgaactgggctgcctgggttcgttggaaaccggcatggccggtgaagaagacggtatt
ggcgccgagggcgtgctggaccacagccagatgctgaccgacccggaagaagccgcggac
ttcgtcaagaagacccaggtggatgccctggccatcgccatcggtaccagccacggcgcc
tacaagttcaccaagccgcctaccggcgacgtactggccatcgaccgtatcaaggaaatc
cacaagcgcatccccaacactcacctggtgatgcacggttcctcttcggtgccgcaagag
tggctggcgatcatcaaccagtacggtggcgacatcaaggaaacctacggcgtgccggtt
gaagaaatcgtcgaaggcatcaagtacggcgtgcgcaaggtcaacatcgacaccgacctg
cgcctggcgtccactggtgccatgcgccgcctgatggccaccaaccccagcgagttcgac
ccgcgcaagttcttcggcgccaccgtgaccgccatgcgcgatgtctgcatcgcccgttac
gaagccttcggcaccgccggcaacgcctcgaagatcaagccgatctctctggaagccatg
ttccagcgttacctcaagggtgagctgaacgccaaggtcaactga

DBGET integrated database retrieval system