KEGG   Pan paniscus (bonobo): 100967376
Entry
100967376         CDS       T02283                                 

Definition
(RefSeq) RLA class II histocompatibility antigen, DP alpha-1 chain-like
  KO
K06752  MHC class II antigen
Organism
pps  Pan paniscus (bonobo)
Pathway
pps04145  Phagosome
pps04514  Cell adhesion molecules
pps04612  Antigen processing and presentation
pps04640  Hematopoietic cell lineage
pps04658  Th1 and Th2 cell differentiation
pps04659  Th17 cell differentiation
pps04672  Intestinal immune network for IgA production
pps04940  Type I diabetes mellitus
pps05140  Leishmaniasis
pps05145  Toxoplasmosis
pps05150  Staphylococcus aureus infection
pps05152  Tuberculosis
pps05164  Influenza A
pps05166  Human T-cell leukemia virus 1 infection
pps05168  Herpes simplex virus 1 infection
pps05169  Epstein-Barr virus infection
pps05310  Asthma
pps05320  Autoimmune thyroid disease
pps05321  Inflammatory bowel disease
pps05322  Systemic lupus erythematosus
pps05323  Rheumatoid arthritis
pps05330  Allograft rejection
pps05332  Graft-versus-host disease
pps05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:pps00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    100967376
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    100967376
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    100967376
   04612 Antigen processing and presentation
    100967376
   04658 Th1 and Th2 cell differentiation
    100967376
   04659 Th17 cell differentiation
    100967376
   04672 Intestinal immune network for IgA production
    100967376
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100967376
   05164 Influenza A
    100967376
   05168 Herpes simplex virus 1 infection
    100967376
   05169 Epstein-Barr virus infection
    100967376
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    100967376
   05152 Tuberculosis
    100967376
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100967376
   05140 Leishmaniasis
    100967376
  09163 Immune disease
   05310 Asthma
    100967376
   05322 Systemic lupus erythematosus
    100967376
   05323 Rheumatoid arthritis
    100967376
   05320 Autoimmune thyroid disease
    100967376
   05321 Inflammatory bowel disease
    100967376
   05330 Allograft rejection
    100967376
   05332 Graft-versus-host disease
    100967376
  09166 Cardiovascular disease
   05416 Viral myocarditis
    100967376
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    100967376
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pps04147]
    100967376
Exosome [BR:pps04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100967376
  Exosomal proteins of epithelial cells
   100967376
  Exosomal proteins of breast milk
   100967376
SSDB
Motif
Pfam: MHC_II_alpha C1-set Ig_3
Other DBs
NCBI-GeneID: 100967376
NCBI-ProteinID: XP_008958927
Position
6
AA seq 381 aa
MAAFSTLLLHPTPPALGTRELLLPFLYAAVWVFGVDVGYGRILKRIIAVRMKVERGILKI
FVLGVGVVAAHGPRGLKGEKREPAVLEPGMLMEGPPGLEGPVVNSLWSLQGLYHPWALYA
PQSGPLLCRAWEEADYNLVSEAWQHQTLFTDHVSTYAEFVQTHRPSGEYMFEFDEEEQFY
VNLDEKEMVWPLPEFIHTFDFGAQRGIAGIVMARKHLNTRINAPTEVSVFPKEPVELGQP
NTLVCHVDKFFPPVLNITWLRNGEPVIEGIAETIFLPSKKLRFHRFHYLTLVPMAEDTCD
LQGEHWGLHQPLLRHWEVQELIQVPETMEMLVCALGLLVGLAGVLNGTIVSKTKRSDSIP
GSRGSYESSYRCIRDRVEKTR
NT seq 1146 nt   +upstreamnt  +downstreamnt
atggctgccttttctaccctgctgctgcaccccacacctcctgctcttggcacccgtgag
cttctgctgcctttcctttatgctgctgtctgggtctttggggttgatgtgggatatggg
agaattttgaaacggatcattgctgtcaggatgaaggtggagaggggcattctgaagatc
tttgttttgggagttggggtggtggctgcccatgggccccgggggctgaagggagagaag
agagagcctgcagtgctggaacctggtatgctcatggaggggccccctggtttagaaggc
cctgtggtgaacagtctgtggtctctgcagggcctgtaccacccctgggcactgtatgcc
ccacagagtgggcctctcctgtgcagggcctgggaagaggctgattataatctggtgtct
gaggcctggcagcaccagactctcttcacagaccatgtgtcaacatatgcagagtttgtg
cagacacacagaccctctggggagtatatgtttgaatttgatgaggaggagcagttctac
gtgaacctggatgagaaggagatggtctggcctctaccagagtttattcacacctttgac
tttggtgctcagaggggtattgctggcatcgtcatggcaaggaagcacttgaacacccgg
atcaatgcccccaccgaggtaagcgtctttcccaaggagcctgtggagctgggccagccc
aacaccctcgtctgccacgttgacaagttcttcccaccagtgctgaacatcacgtggctg
cgcaatggggagccagtcattgagggtattgcagagaccatcttcctgcccagcaagaaa
ctcagattccacaggttccactatctgaccctcgttcccatggccgaggacacctgtgac
ctccagggggagcactggggcctgcaccagcctctcctcaggcactgggaagtccaggaa
ctaatccaggtgcctgagaccatggagatgctggtctgtgccctcggcctgctggtgggc
ctggcgggggtccttaatggcaccattgtctcaaagaccaagcgatctgacagcatcccc
gggtccaggggctcctatgagtcatcctataggtgtattagggacagagtggaaaagacg
aggtaa

KEGG   Pan paniscus (bonobo): 100967723
Entry
100967723         CDS       T02283                                 

Definition
(RefSeq) HLA class II histocompatibility antigen, DO alpha chain
  KO
K06752  MHC class II antigen
Organism
pps  Pan paniscus (bonobo)
Pathway
pps04145  Phagosome
pps04514  Cell adhesion molecules
pps04612  Antigen processing and presentation
pps04640  Hematopoietic cell lineage
pps04658  Th1 and Th2 cell differentiation
pps04659  Th17 cell differentiation
pps04672  Intestinal immune network for IgA production
pps04940  Type I diabetes mellitus
pps05140  Leishmaniasis
pps05145  Toxoplasmosis
pps05150  Staphylococcus aureus infection
pps05152  Tuberculosis
pps05164  Influenza A
pps05166  Human T-cell leukemia virus 1 infection
pps05168  Herpes simplex virus 1 infection
pps05169  Epstein-Barr virus infection
pps05310  Asthma
pps05320  Autoimmune thyroid disease
pps05321  Inflammatory bowel disease
pps05322  Systemic lupus erythematosus
pps05323  Rheumatoid arthritis
pps05330  Allograft rejection
pps05332  Graft-versus-host disease
pps05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:pps00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    100967723
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    100967723
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    100967723
   04612 Antigen processing and presentation
    100967723
   04658 Th1 and Th2 cell differentiation
    100967723
   04659 Th17 cell differentiation
    100967723
   04672 Intestinal immune network for IgA production
    100967723
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100967723
   05164 Influenza A
    100967723
   05168 Herpes simplex virus 1 infection
    100967723
   05169 Epstein-Barr virus infection
    100967723
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    100967723
   05152 Tuberculosis
    100967723
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100967723
   05140 Leishmaniasis
    100967723
  09163 Immune disease
   05310 Asthma
    100967723
   05322 Systemic lupus erythematosus
    100967723
   05323 Rheumatoid arthritis
    100967723
   05320 Autoimmune thyroid disease
    100967723
   05321 Inflammatory bowel disease
    100967723
   05330 Allograft rejection
    100967723
   05332 Graft-versus-host disease
    100967723
  09166 Cardiovascular disease
   05416 Viral myocarditis
    100967723
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    100967723
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pps04147]
    100967723
Exosome [BR:pps04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100967723
  Exosomal proteins of epithelial cells
   100967723
  Exosomal proteins of breast milk
   100967723
SSDB
Motif
Pfam: MHC_II_alpha C1-set Ig_3 C2-set_2 Marek_A
Other DBs
NCBI-GeneID: 100967723
NCBI-ProteinID: XP_003808647
UniProt: A0A2R9BAA3
Position
6
AA seq 250 aa
MALRAGLILGFHTLMTLLSPQEAGATKADHMGSYGPAFYQSYGASGQFTHEFDGEQLFSV
DLKKSEAVWRLPEFGDFARFDPQGGLAGIAAIKAHLDILVERSNRSRAINVPPRVTVLPK
SQVELGQPNILICIVDNIFPPVINITWLRNGQTVTEGVAQTSFYSQPDHLFRKFHYLPFV
PSAEDVYDCQVEHWGLDAPLLRHWELQVPIPPPDAMETLVCALGLAIGLVGFLVGTVLII
MGTYVSSVPR
NT seq 753 nt   +upstreamnt  +downstreamnt
atggccctcagagcagggctgatcctggggttccacaccctgatgaccctcctgagcccg
caggaggcaggggccaccaaggctgaccacatgggctcctacggacccgccttctaccag
tcttacggcgcctcgggccagttcacccatgaatttgatggggaacagctgttctctgtg
gacctgaagaaaagcgaggccgtgtggcgtctgcctgagtttggcgactttgcccgcttt
gacccgcagggtgggctggccggcatcgccgcaatcaaagcccatctggacatcctggtg
gagcgctccaaccgcagcagagccatcaacgtgcctccacgggtgaccgtgctccccaag
tctcaggtggagctgggccagcccaacatcctcatctgcatcgtggacaacatcttcccc
cctgtgatcaatatcacctggctgcgcaatggccaaactgtcactgagggagtggcccag
accagcttctattcccagcctgaccatttgttccgcaagttccactacctgcccttcgtg
ccctcagccgaggacgtctatgactgccaggtggagcactggggcctggatgcaccactc
ctcaggcattgggagctccaggtgcctattccaccaccagatgccatggagaccctggtc
tgtgccctgggcctggccatcggcctggtaggcttcctcgtgggcaccgtcctcatcatc
atgggcacatatgtgtccagtgtccccaggtaa

KEGG   Pan paniscus (bonobo): 100968410
Entry
100968410         CDS       T02283                                 

Gene name
MHC-DMB
Definition
(RefSeq) HLA class II histocompatibility antigen, DM beta chain
  KO
K06752  MHC class II antigen
Organism
pps  Pan paniscus (bonobo)
Pathway
pps04145  Phagosome
pps04514  Cell adhesion molecules
pps04612  Antigen processing and presentation
pps04640  Hematopoietic cell lineage
pps04658  Th1 and Th2 cell differentiation
pps04659  Th17 cell differentiation
pps04672  Intestinal immune network for IgA production
pps04940  Type I diabetes mellitus
pps05140  Leishmaniasis
pps05145  Toxoplasmosis
pps05150  Staphylococcus aureus infection
pps05152  Tuberculosis
pps05164  Influenza A
pps05166  Human T-cell leukemia virus 1 infection
pps05168  Herpes simplex virus 1 infection
pps05169  Epstein-Barr virus infection
pps05310  Asthma
pps05320  Autoimmune thyroid disease
pps05321  Inflammatory bowel disease
pps05322  Systemic lupus erythematosus
pps05323  Rheumatoid arthritis
pps05330  Allograft rejection
pps05332  Graft-versus-host disease
pps05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:pps00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    100968410 (MHC-DMB)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    100968410 (MHC-DMB)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    100968410 (MHC-DMB)
   04612 Antigen processing and presentation
    100968410 (MHC-DMB)
   04658 Th1 and Th2 cell differentiation
    100968410 (MHC-DMB)
   04659 Th17 cell differentiation
    100968410 (MHC-DMB)
   04672 Intestinal immune network for IgA production
    100968410 (MHC-DMB)
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100968410 (MHC-DMB)
   05164 Influenza A
    100968410 (MHC-DMB)
   05168 Herpes simplex virus 1 infection
    100968410 (MHC-DMB)
   05169 Epstein-Barr virus infection
    100968410 (MHC-DMB)
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    100968410 (MHC-DMB)
   05152 Tuberculosis
    100968410 (MHC-DMB)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100968410 (MHC-DMB)
   05140 Leishmaniasis
    100968410 (MHC-DMB)
  09163 Immune disease
   05310 Asthma
    100968410 (MHC-DMB)
   05322 Systemic lupus erythematosus
    100968410 (MHC-DMB)
   05323 Rheumatoid arthritis
    100968410 (MHC-DMB)
   05320 Autoimmune thyroid disease
    100968410 (MHC-DMB)
   05321 Inflammatory bowel disease
    100968410 (MHC-DMB)
   05330 Allograft rejection
    100968410 (MHC-DMB)
   05332 Graft-versus-host disease
    100968410 (MHC-DMB)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    100968410 (MHC-DMB)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    100968410 (MHC-DMB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pps04147]
    100968410 (MHC-DMB)
Exosome [BR:pps04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100968410 (MHC-DMB)
  Exosomal proteins of epithelial cells
   100968410 (MHC-DMB)
  Exosomal proteins of breast milk
   100968410 (MHC-DMB)
SSDB
Motif
Pfam: MHC_II_beta C1-set Ig_3 Ig_2 C2-set_2 I-set ig SPARK
Other DBs
NCBI-GeneID: 100968410
NCBI-ProteinID: XP_003808649
Position
6
AA seq 263 aa
MITFLPLLLGLSLGCTGAGGFVAHVESSCLLDDAGTPKDFTYCISFNKDLLTCWDPEENK
MAPCEFGVLNSLANFLSQHLNQQDTLMQRLRNGLQNCATHTQPFWGSLTNRTRPPSVQVA
KTTPFNTREPVMLACYVWGFYPAEVTITWRKNGKLVMPHSSAHKTAQPNGDWTYQTLSHL
ALTPSYGDTYTCVVEHIGAPEPILRDWTPGLSPMQTLKVSVSAVTLGLGLIIFSLGVISW
RRAGHSSYTPLPGSNYSEGRHIF
NT seq 792 nt   +upstreamnt  +downstreamnt
atgatcactttcctgccgctgctgctggggctcagcctgggctgcacaggagcaggtggc
ttcgtggcccacgtggaaagctcctgtctgttggatgatgctgggactccaaaggatttc
acatactgcatctccttcaacaaggatctgctgacctgctgggatccagaggagaataag
atggccccttgcgaatttggggtgctgaatagcttggcgaatttcctctcacagcacctc
aaccaacaagacaccctgatgcagcgcttgcgcaatgggcttcagaattgtgccacacac
acccagcccttctggggatcactgaccaacaggacacggccaccatctgtgcaagtagcc
aaaaccactccttttaacacgagggagcctgtgatgctggcctgctatgtgtggggcttc
tatccagcagaagtgaccatcacgtggaggaagaacgggaagcttgtcatgcctcacagc
agtgcgcacaagactgcccagcccaatggagactggacataccagaccctctcccattta
gccttaaccccctcttacggggacacttacacctgtgtggtagagcacattggggctcct
gagcccatccttcgggactggacacctgggctgtcccccatgcagaccctgaaggtttct
gtgtctgcagtgactctgggcctgggcctcatcatcttctctcttggtgtgatcagttgg
cggagagctggccactctagttacactcctcttcctgggtccaattattcagaaggacgg
cacattttctag

KEGG   Pan paniscus (bonobo): 100968989
Entry
100968989         CDS       T02283                                 

Definition
(RefSeq) HLA class II histocompatibility antigen, DM alpha chain
  KO
K06752  MHC class II antigen
Organism
pps  Pan paniscus (bonobo)
Pathway
pps04145  Phagosome
pps04514  Cell adhesion molecules
pps04612  Antigen processing and presentation
pps04640  Hematopoietic cell lineage
pps04658  Th1 and Th2 cell differentiation
pps04659  Th17 cell differentiation
pps04672  Intestinal immune network for IgA production
pps04940  Type I diabetes mellitus
pps05140  Leishmaniasis
pps05145  Toxoplasmosis
pps05150  Staphylococcus aureus infection
pps05152  Tuberculosis
pps05164  Influenza A
pps05166  Human T-cell leukemia virus 1 infection
pps05168  Herpes simplex virus 1 infection
pps05169  Epstein-Barr virus infection
pps05310  Asthma
pps05320  Autoimmune thyroid disease
pps05321  Inflammatory bowel disease
pps05322  Systemic lupus erythematosus
pps05323  Rheumatoid arthritis
pps05330  Allograft rejection
pps05332  Graft-versus-host disease
pps05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:pps00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    100968989
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    100968989
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    100968989
   04612 Antigen processing and presentation
    100968989
   04658 Th1 and Th2 cell differentiation
    100968989
   04659 Th17 cell differentiation
    100968989
   04672 Intestinal immune network for IgA production
    100968989
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100968989
   05164 Influenza A
    100968989
   05168 Herpes simplex virus 1 infection
    100968989
   05169 Epstein-Barr virus infection
    100968989
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    100968989
   05152 Tuberculosis
    100968989
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100968989
   05140 Leishmaniasis
    100968989
  09163 Immune disease
   05310 Asthma
    100968989
   05322 Systemic lupus erythematosus
    100968989
   05323 Rheumatoid arthritis
    100968989
   05320 Autoimmune thyroid disease
    100968989
   05321 Inflammatory bowel disease
    100968989
   05330 Allograft rejection
    100968989
   05332 Graft-versus-host disease
    100968989
  09166 Cardiovascular disease
   05416 Viral myocarditis
    100968989
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    100968989
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pps04147]
    100968989
Exosome [BR:pps04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100968989
  Exosomal proteins of epithelial cells
   100968989
  Exosomal proteins of breast milk
   100968989
SSDB
Motif
Pfam: MHC_II_alpha C1-set SKG6 FAST_1
Other DBs
NCBI-GeneID: 100968989
NCBI-ProteinID: XP_008958910
Position
6
AA seq 362 aa
MTRAPIGNDLAKHDLRPPSGGGSWGSWVGWVGSSYLLCGEKVWVMNRTKELRCYRCYHFC
GCYPTPGPSLKVSCWLSDSCQELQRRGIILCSYGVTSSSAVFGRPGRLRNRRHFERRLVP
MKWLKKCLDTAPTPMWRDDLQNHTFLHTVYCQDGSPGVGLSEAYDEDQLFFFDFSQNTRV
PRLPEFADWAQEQGDAPAILFDKEFCESMIQQIGPKVDGKIPVSRGFPIAEVFTLKPLEF
GKPNTLVCFVSNLFPPMLTVNWQHHSVPVEGFGPTFVSAVDGLSFQAFSYLNFTPEPSDI
FSCIVTHEIDRYTAIAYWVPRNALPSDLLENVLCGVAFGLGVLGIIVGIVLIIYFRKPCS
GD
NT seq 1089 nt   +upstreamnt  +downstreamnt
atgacaagggcacctattggaaatgatctggcaaaacatgatctaaggccaccctctggg
ggagggagttggggaagctgggttggctgggttggtagctcctacctactgtgtggcgag
aaggtatgggtcatgaacagaaccaaggagctgcgctgctacagatgctaccacttctgt
ggctgctaccccactcctgggccgtccctgaaggtttcctgctggctgagcgattcctgc
caagagcttcaaagaagagggattattttatgcagttatggggtcacttcttccagtgct
gtctttgggaggcctggtaggttaaggaacagaagacattttgagagacgcttggtgcca
atgaagtggctgaagaaatgtctggatacagctcctactccaatgtggcgagatgacctg
caaaaccacacattcctgcacacagtgtactgccaggatgggagtcccggtgtgggactg
tctgaggcctacgacgaggaccagcttttcttcttcgacttttcccagaacactcgggtg
cctcgcctgcccgaatttgctgactgggctcaggaacagggagatgctcctgccatttta
tttgacaaagagttctgcgagtcgatgatccagcaaatagggccaaaagttgatgggaaa
atcccggtgtccagagggtttcctatcgctgaagtgttcacgctgaagcccctggagttt
ggcaagcccaacactttggtctgttttgtcagtaatctcttcccacccatgctgacagtg
aactggcagcatcattccgtccctgtggaaggatttgggcctacttttgtctcagctgtc
gatggactcagcttccaggccttttcttacttaaacttcacaccagaaccttctgacatt
ttctcctgcattgtgactcacgaaattgaccgctacacagcaattgcctattgggtgccc
cggaacgcactgccctcagatctgctggagaatgtgctgtgtggtgtggcctttggcctg
ggtgtgctgggcatcatcgtgggcattgttctcatcatctacttccggaagccttgctca
ggtgactga

KEGG   Pan paniscus (bonobo): 100970847
Entry
100970847         CDS       T02283                                 

Definition
(RefSeq) HLA class II histocompatibility antigen, DO beta chain
  KO
K06752  MHC class II antigen
Organism
pps  Pan paniscus (bonobo)
Pathway
pps04145  Phagosome
pps04514  Cell adhesion molecules
pps04612  Antigen processing and presentation
pps04640  Hematopoietic cell lineage
pps04658  Th1 and Th2 cell differentiation
pps04659  Th17 cell differentiation
pps04672  Intestinal immune network for IgA production
pps04940  Type I diabetes mellitus
pps05140  Leishmaniasis
pps05145  Toxoplasmosis
pps05150  Staphylococcus aureus infection
pps05152  Tuberculosis
pps05164  Influenza A
pps05166  Human T-cell leukemia virus 1 infection
pps05168  Herpes simplex virus 1 infection
pps05169  Epstein-Barr virus infection
pps05310  Asthma
pps05320  Autoimmune thyroid disease
pps05321  Inflammatory bowel disease
pps05322  Systemic lupus erythematosus
pps05323  Rheumatoid arthritis
pps05330  Allograft rejection
pps05332  Graft-versus-host disease
pps05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:pps00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    100970847
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    100970847
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    100970847
   04612 Antigen processing and presentation
    100970847
   04658 Th1 and Th2 cell differentiation
    100970847
   04659 Th17 cell differentiation
    100970847
   04672 Intestinal immune network for IgA production
    100970847
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100970847
   05164 Influenza A
    100970847
   05168 Herpes simplex virus 1 infection
    100970847
   05169 Epstein-Barr virus infection
    100970847
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    100970847
   05152 Tuberculosis
    100970847
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100970847
   05140 Leishmaniasis
    100970847
  09163 Immune disease
   05310 Asthma
    100970847
   05322 Systemic lupus erythematosus
    100970847
   05323 Rheumatoid arthritis
    100970847
   05320 Autoimmune thyroid disease
    100970847
   05321 Inflammatory bowel disease
    100970847
   05330 Allograft rejection
    100970847
   05332 Graft-versus-host disease
    100970847
  09166 Cardiovascular disease
   05416 Viral myocarditis
    100970847
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    100970847
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pps04147]
    100970847
Exosome [BR:pps04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100970847
  Exosomal proteins of epithelial cells
   100970847
  Exosomal proteins of breast milk
   100970847
SSDB
Motif
Pfam: MHC_II_beta C1-set ig C2-set_2 MHC_I
Other DBs
NCBI-GeneID: 100970847
NCBI-ProteinID: XP_008958918
Position
6
AA seq 273 aa
MGSGWVPWVVALLVNLTRLDSSMTQGTDSPEDFVIQAKADCYFTNGTEKVQFVVRFIFNL
EEYVRFDSDVGMFVALTKLGQPDAEQWNSRLDLLERSRQAVDGVCRHNYRLGAPFTVGRK
VQPEVTVYPERTPLLHQHNLLHCSVTGFYPGDIKIRWFLNGQEERAGVMSTGPIRNGDWT
FQTVVMLEMTPELGHVYTCLVDHSSLLSPVSVEWRAQSEYSWKKMLSGIAAFLLGLIFLL
VGIVIQLRAQKGYVRTQMSGNEVSRAVLLPQSC
NT seq 822 nt   +upstreamnt  +downstreamnt
atgggttctgggtgggtcccctgggtggtggctctgctagtgaatctgacccgactggat
tcctccatgactcaaggcacagactctccagaagattttgtgattcaggcaaaggctgac
tgttacttcaccaacgggacagaaaaggtgcagtttgtggtcagattcatctttaacttg
gaggagtatgtacgtttcgacagtgatgtggggatgtttgtggcattgaccaagctgggg
cagccagatgctgagcagtggaacagccggctggatctcttggagaggagcagacaggcc
gtggatggggtctgtagacacaactacaggctgggcgcacccttcactgtggggagaaaa
gtgcaaccagaggtgacagtgtacccagagaggaccccactcctgcaccagcataatctg
ctgcactgctctgtgacaggcttctatccaggggatatcaagatcaggtggttcctgaat
gggcaggaggagagagctggggtcatgtccaccggccctatcaggaatggagactggacc
tttcagactgtggtgatgctagaaatgactcctgaacttggacatgtctacacctgcctt
gtcgatcactccagcctgctgagccctgtttctgtggagtggagagctcagtctgaatat
tcttggaaaaagatgctgagtggcattgcagccttcctacttgggctaatcttccttctg
gtgggaatcgtcatccagctaagggctcagaaaggatatgtgaggacgcagatgtctggt
aatgaggtctcaagagctgttctgctccctcagtcatgctaa

KEGG   Pan paniscus (bonobo): 100972641
Entry
100972641         CDS       T02283                                 

Definition
(RefSeq) HLA class II histocompatibility antigen, DQ beta 2 chain
  KO
K06752  MHC class II antigen
Organism
pps  Pan paniscus (bonobo)
Pathway
pps04145  Phagosome
pps04514  Cell adhesion molecules
pps04612  Antigen processing and presentation
pps04640  Hematopoietic cell lineage
pps04658  Th1 and Th2 cell differentiation
pps04659  Th17 cell differentiation
pps04672  Intestinal immune network for IgA production
pps04940  Type I diabetes mellitus
pps05140  Leishmaniasis
pps05145  Toxoplasmosis
pps05150  Staphylococcus aureus infection
pps05152  Tuberculosis
pps05164  Influenza A
pps05166  Human T-cell leukemia virus 1 infection
pps05168  Herpes simplex virus 1 infection
pps05169  Epstein-Barr virus infection
pps05310  Asthma
pps05320  Autoimmune thyroid disease
pps05321  Inflammatory bowel disease
pps05322  Systemic lupus erythematosus
pps05323  Rheumatoid arthritis
pps05330  Allograft rejection
pps05332  Graft-versus-host disease
pps05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:pps00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    100972641
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    100972641
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    100972641
   04612 Antigen processing and presentation
    100972641
   04658 Th1 and Th2 cell differentiation
    100972641
   04659 Th17 cell differentiation
    100972641
   04672 Intestinal immune network for IgA production
    100972641
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100972641
   05164 Influenza A
    100972641
   05168 Herpes simplex virus 1 infection
    100972641
   05169 Epstein-Barr virus infection
    100972641
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    100972641
   05152 Tuberculosis
    100972641
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100972641
   05140 Leishmaniasis
    100972641
  09163 Immune disease
   05310 Asthma
    100972641
   05322 Systemic lupus erythematosus
    100972641
   05323 Rheumatoid arthritis
    100972641
   05320 Autoimmune thyroid disease
    100972641
   05321 Inflammatory bowel disease
    100972641
   05330 Allograft rejection
    100972641
   05332 Graft-versus-host disease
    100972641
  09166 Cardiovascular disease
   05416 Viral myocarditis
    100972641
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    100972641
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pps04147]
    100972641
Exosome [BR:pps04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100972641
  Exosomal proteins of epithelial cells
   100972641
  Exosomal proteins of breast milk
   100972641
SSDB
Motif
Pfam: MHC_II_beta C1-set Ig_3 C2-set_2 Ig_2 ig MHC_I PI-TkoII_IV
Other DBs
NCBI-GeneID: 100972641
NCBI-ProteinID: XP_003808658
Position
6
AA seq 279 aa
MSWKMALQIPGGFWAAAVTVMLVMLSTPVAEARDFPKDFLVQFKGMCYFTNGTERVRGVA
RYIYNREEYGRFDSDVGEFQAVTELGRSIEDWNNYKDFLEQERAAVDKVCRHNYEAELRT
TLQRQVEPTVTISPSRTEALNHHNLLVCSVTDFYPAQIKVRWFRNDQEETAGVVSTSLIR
NGDWTFQILVMLEITPQHGDIYTCHVEHPSLQSPITVEWRAQSESAQSKMLSGVGGFMLG
LIFLGLGLIIRHRGQKGPRGPPPAGNISAMIQSGERAQA
NT seq 840 nt   +upstreamnt  +downstreamnt
atgtcttggaagatggctctgcagatccctggaggcttttgggcagcagctgtgaccgtg
atgctggtgatgctgagcaccccagtggctgaggccagagactttcccaaggatttcttg
gtccagtttaagggcatgtgctacttcaccaacgggacagagcgcgtgcggggtgtggcc
agatacatctataaccgcgaggagtacgggcgcttcgacagcgacgttggggagttccag
gcggtgaccgagctggggcggagcatcgaggactggaacaactataaggacttcttggag
caggagcgggccgcggtggacaaggtgtgcagacacaactacgaggcggagctacgcacg
accttgcagcggcaagtggagcccacagtgaccatctccccatccaggacagaggccctc
aaccaccacaacctgctggtctgctcggtgacagatttctatccagcccagatcaaagtc
cggtggtttcggaatgaccaggaggagacagccggtgttgtgtccacttccctcattagg
aacggtgactggaccttccagattctggtgatgctggaaataactccccagcatggagac
atctacacctgccacgtggagcaccccagcctccagagccccatcaccgtggagtggcgg
gctcagtctgaatctgcccagagcaagatgctgagtggtgttggaggcttcatgctgggg
ctgatcttcctcgggctgggccttatcatccgtcacaggggtcagaaaggacctcgaggg
cctccaccagcaggtaatatttcagccatgatccagtcaggggagagggcacaggcataa

KEGG   Pan paniscus (bonobo): 100972994
Entry
100972994         CDS       T02283                                 

Definition
(RefSeq) HLA class II histocompatibility antigen, DQ beta 1 chain
  KO
K06752  MHC class II antigen
Organism
pps  Pan paniscus (bonobo)
Pathway
pps04145  Phagosome
pps04514  Cell adhesion molecules
pps04612  Antigen processing and presentation
pps04640  Hematopoietic cell lineage
pps04658  Th1 and Th2 cell differentiation
pps04659  Th17 cell differentiation
pps04672  Intestinal immune network for IgA production
pps04940  Type I diabetes mellitus
pps05140  Leishmaniasis
pps05145  Toxoplasmosis
pps05150  Staphylococcus aureus infection
pps05152  Tuberculosis
pps05164  Influenza A
pps05166  Human T-cell leukemia virus 1 infection
pps05168  Herpes simplex virus 1 infection
pps05169  Epstein-Barr virus infection
pps05310  Asthma
pps05320  Autoimmune thyroid disease
pps05321  Inflammatory bowel disease
pps05322  Systemic lupus erythematosus
pps05323  Rheumatoid arthritis
pps05330  Allograft rejection
pps05332  Graft-versus-host disease
pps05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:pps00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    100972994
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    100972994
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    100972994
   04612 Antigen processing and presentation
    100972994
   04658 Th1 and Th2 cell differentiation
    100972994
   04659 Th17 cell differentiation
    100972994
   04672 Intestinal immune network for IgA production
    100972994
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100972994
   05164 Influenza A
    100972994
   05168 Herpes simplex virus 1 infection
    100972994
   05169 Epstein-Barr virus infection
    100972994
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    100972994
   05152 Tuberculosis
    100972994
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100972994
   05140 Leishmaniasis
    100972994
  09163 Immune disease
   05310 Asthma
    100972994
   05322 Systemic lupus erythematosus
    100972994
   05323 Rheumatoid arthritis
    100972994
   05320 Autoimmune thyroid disease
    100972994
   05321 Inflammatory bowel disease
    100972994
   05330 Allograft rejection
    100972994
   05332 Graft-versus-host disease
    100972994
  09166 Cardiovascular disease
   05416 Viral myocarditis
    100972994
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    100972994
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pps04147]
    100972994
Exosome [BR:pps04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100972994
  Exosomal proteins of epithelial cells
   100972994
  Exosomal proteins of breast milk
   100972994
SSDB
Motif
Pfam: MHC_II_beta C1-set Ig_3 C2-set_2 ig MHC_I
Other DBs
NCBI-GeneID: 100972994
NCBI-ProteinID: XP_003808659
UniProt: A0A2R9CFN7
Position
6
AA seq 261 aa
MSWKKALRIPGDLRVATVTLMLAMLSSLLAEGRDSPEDFVFQFKGMCYFTNGTERVRLVT
RYIYNREEYVRFYSDVGVYRAVTPQGRPDAEYWNSQKEVLERTRAELDTVCRHNYEVTYR
GILQRRVEPTVTISPSRTEALNHHNLLVCSVTDFYPGQIKVRWFRNDQEETAGVVSTPLI
RNGDWTFQILVMLEMTPQRGEVYTCHVEHPSLQSPITVEWRAQSESAQSKMLSGVGGFVL
GLIFLGLGLIIRQRSQKGLLH
NT seq 786 nt   +upstreamnt  +downstreamnt
atgtcttggaagaaggctttgcggatccccggagaccttcgggtagcaactgtcaccttg
atgctggcgatgctgagctccctactggctgagggcagagactctcccgaggatttcgtg
ttccagtttaagggcatgtgctacttcaccaacgggacggagcgcgtgcgtcttgtaacc
agatacatctataaccgagaggagtacgtgcgcttctacagcgacgtgggggtgtaccgc
gcggtgacgccgcaggggcggcctgacgccgagtactggaacagccagaaggaagtcctg
gagaggacccgggcggagttggacacggtgtgcagacacaactacgaggtgacgtaccgc
gggatcttgcagaggagagtggagcccacagtgaccatctccccatccaggacagaggcc
ctcaaccaccacaacctgctggtctgctcggtgacagatttctatccaggccagatcaaa
gtccggtggtttcggaatgaccaggaggagacagccggcgttgtgtccaccccccttatt
aggaatggtgactggactttccagatcctggtgatgctggaaatgactccccagcgtgga
gaagtctacacctgccacgtggagcaccccagcctccagagccccatcaccgtggagtgg
cgggctcagtctgaatctgcccagagcaagatgctgagtggcgttggaggcttcgtgctg
gggctgatcttccttgggctgggccttatcatccgtcaaaggagtcagaaagggcttctg
cactga

KEGG   Pan paniscus (bonobo): 100973583
Entry
100973583         CDS       T02283                                 

Definition
(RefSeq) HLA class II histocompatibility antigen, DQ alpha 2 chain
  KO
K06752  MHC class II antigen
Organism
pps  Pan paniscus (bonobo)
Pathway
pps04145  Phagosome
pps04514  Cell adhesion molecules
pps04612  Antigen processing and presentation
pps04640  Hematopoietic cell lineage
pps04658  Th1 and Th2 cell differentiation
pps04659  Th17 cell differentiation
pps04672  Intestinal immune network for IgA production
pps04940  Type I diabetes mellitus
pps05140  Leishmaniasis
pps05145  Toxoplasmosis
pps05150  Staphylococcus aureus infection
pps05152  Tuberculosis
pps05164  Influenza A
pps05166  Human T-cell leukemia virus 1 infection
pps05168  Herpes simplex virus 1 infection
pps05169  Epstein-Barr virus infection
pps05310  Asthma
pps05320  Autoimmune thyroid disease
pps05321  Inflammatory bowel disease
pps05322  Systemic lupus erythematosus
pps05323  Rheumatoid arthritis
pps05330  Allograft rejection
pps05332  Graft-versus-host disease
pps05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:pps00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    100973583
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    100973583
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    100973583
   04612 Antigen processing and presentation
    100973583
   04658 Th1 and Th2 cell differentiation
    100973583
   04659 Th17 cell differentiation
    100973583
   04672 Intestinal immune network for IgA production
    100973583
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100973583
   05164 Influenza A
    100973583
   05168 Herpes simplex virus 1 infection
    100973583
   05169 Epstein-Barr virus infection
    100973583
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    100973583
   05152 Tuberculosis
    100973583
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100973583
   05140 Leishmaniasis
    100973583
  09163 Immune disease
   05310 Asthma
    100973583
   05322 Systemic lupus erythematosus
    100973583
   05323 Rheumatoid arthritis
    100973583
   05320 Autoimmune thyroid disease
    100973583
   05321 Inflammatory bowel disease
    100973583
   05330 Allograft rejection
    100973583
   05332 Graft-versus-host disease
    100973583
  09166 Cardiovascular disease
   05416 Viral myocarditis
    100973583
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    100973583
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pps04147]
    100973583
Exosome [BR:pps04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100973583
  Exosomal proteins of epithelial cells
   100973583
  Exosomal proteins of breast milk
   100973583
SSDB
Motif
Pfam: MHC_II_alpha C1-set C2-set_2 Ig_3 Marek_A WW
Other DBs
NCBI-GeneID: 100973583
NCBI-ProteinID: XP_003808661
UniProt: A0A2R9BJY2
Position
6
AA seq 255 aa
MILNKALLLGALALTAVMSPCGGEDIVADHVASYGVNFYQSHGPSGQYTHEFDGDEEFYV
DLETKETVWQLPMFSKFISFDPQSALRNMAVGKHTLEFMIKQSNSTAATNEVPEVTVFSK
FPVTLDQPNTLICLVDNIFPPVVNITWLSNGHSVTEGVSETSFLSKSDHSFFKISYLTFL
PSADEIYDCKVEHWGLDEPLLKHWEPEIPAPMSELTETLVCALGLSAGLMGIVVGTVFII
QGLHSVGASRHQGLL
NT seq 768 nt   +upstreamnt  +downstreamnt
atgatcctaaacaaagctctgctgctgggggccctcgccctgactgccgtgatgagcccc
tgtggaggtgaagacattgtggctgaccatgttgcctcctatggtgtgaacttctaccag
tctcacggtccctctggccagtacacccatgaatttgatggagacgaggagttctacgtg
gacctggagacgaaagagactgtctggcagttgcctatgtttagcaaatttataagtttt
gacccgcagagtgcactgagaaatatggctgtgggaaaacacaccttggaattcatgatt
aaacagtccaactctaccgctgccaccaatgaggttcctgaggtcacagtgttttccaag
tttcctgtgacgctggatcagcccaacaccctcatctgtcttgtggacaacatctttcct
cctgtggtcaacatcacatggctgagcaatgggcactcagtcacagaaggtgtttctgag
accagcttcctctccaagagtgatcattccttcttcaagatcagttacctcaccttcctc
ccttctgctgatgagatttatgactgcaaggtggaacactggggcctggacgagcctctt
ctgaaacactgggagcctgagattccagcccctatgtcagagctcacagagactttggtc
tgcgccctggggttgtctgcgggcctcatgggcattgtggtgggcactgtcttcatcatc
caaggcctgcattcagttggtgcttccagacaccaagggctcttgtga

KEGG   Pan paniscus (bonobo): 100979649
Entry
100979649         CDS       T02283                                 

Definition
(RefSeq) HLA class II histocompatibility antigen, DQ alpha 2 chain-like
  KO
K06752  MHC class II antigen
Organism
pps  Pan paniscus (bonobo)
Pathway
pps04145  Phagosome
pps04514  Cell adhesion molecules
pps04612  Antigen processing and presentation
pps04640  Hematopoietic cell lineage
pps04658  Th1 and Th2 cell differentiation
pps04659  Th17 cell differentiation
pps04672  Intestinal immune network for IgA production
pps04940  Type I diabetes mellitus
pps05140  Leishmaniasis
pps05145  Toxoplasmosis
pps05150  Staphylococcus aureus infection
pps05152  Tuberculosis
pps05164  Influenza A
pps05166  Human T-cell leukemia virus 1 infection
pps05168  Herpes simplex virus 1 infection
pps05169  Epstein-Barr virus infection
pps05310  Asthma
pps05320  Autoimmune thyroid disease
pps05321  Inflammatory bowel disease
pps05322  Systemic lupus erythematosus
pps05323  Rheumatoid arthritis
pps05330  Allograft rejection
pps05332  Graft-versus-host disease
pps05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:pps00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    100979649
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    100979649
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    100979649
   04612 Antigen processing and presentation
    100979649
   04658 Th1 and Th2 cell differentiation
    100979649
   04659 Th17 cell differentiation
    100979649
   04672 Intestinal immune network for IgA production
    100979649
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100979649
   05164 Influenza A
    100979649
   05168 Herpes simplex virus 1 infection
    100979649
   05169 Epstein-Barr virus infection
    100979649
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    100979649
   05152 Tuberculosis
    100979649
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100979649
   05140 Leishmaniasis
    100979649
  09163 Immune disease
   05310 Asthma
    100979649
   05322 Systemic lupus erythematosus
    100979649
   05323 Rheumatoid arthritis
    100979649
   05320 Autoimmune thyroid disease
    100979649
   05321 Inflammatory bowel disease
    100979649
   05330 Allograft rejection
    100979649
   05332 Graft-versus-host disease
    100979649
  09166 Cardiovascular disease
   05416 Viral myocarditis
    100979649
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    100979649
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pps04147]
    100979649
Exosome [BR:pps04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100979649
  Exosomal proteins of epithelial cells
   100979649
  Exosomal proteins of breast milk
   100979649
SSDB
Motif
Pfam: MHC_II_alpha C1-set Ig_3
Other DBs
NCBI-GeneID: 100979649
NCBI-ProteinID: XP_008958928
UniProt: A0A2R8ZLG1
Position
6
AA seq 170 aa
MILNKALMLGALALTTVMSPCGGEDIVADHVASCGVNLYQFYGPSGQYTHEFDGDEQFYV
DLEKKETAWRWPEFSKFGGVDPQGALRNMAVAKHNLNIMIKRYNSTTATNEVPEVTVFSK
SPVTLGQPNTLICLVDNIFPPVLNVTWLSNGHSVTEGVSETSFLSKSDHS
NT seq 510 nt   +upstreamnt  +downstreamnt
atgatcctaaacaaagctctgatgctgggggccctcgccctgaccactgtgatgagccct
tgtggaggtgaagacattgtggctgaccacgttgcctcttgtggtgtaaacttgtaccag
ttttacggtccctctggccagtacacccatgaatttgatggagatgagcagttctacgtg
gacctggagaagaaggagactgcctggcggtggcctgagttcagcaaatttggaggtgtt
gacccacagggtgcactgagaaacatggctgtggcaaaacacaacttgaacatcatgatt
aaacgctacaactctaccactgctaccaatgaggttcctgaggtcacagtgttttccaaa
tctcccgtgacactgggtcagcccaacaccctcatctgtcttgtggacaacatctttcct
cctgtgctcaacgtcacatggctgagcaatgggcactcagtcacagaaggtgtttctgag
accagcttcctctccaagagtgatcattcc

KEGG   Pan paniscus (bonobo): 100986750
Entry
100986750         CDS       T02283                                 

Definition
(RefSeq) HLA class II histocompatibility antigen, DRB1-4 beta chain
  KO
K06752  MHC class II antigen
Organism
pps  Pan paniscus (bonobo)
Pathway
pps04145  Phagosome
pps04514  Cell adhesion molecules
pps04612  Antigen processing and presentation
pps04640  Hematopoietic cell lineage
pps04658  Th1 and Th2 cell differentiation
pps04659  Th17 cell differentiation
pps04672  Intestinal immune network for IgA production
pps04940  Type I diabetes mellitus
pps05140  Leishmaniasis
pps05145  Toxoplasmosis
pps05150  Staphylococcus aureus infection
pps05152  Tuberculosis
pps05164  Influenza A
pps05166  Human T-cell leukemia virus 1 infection
pps05168  Herpes simplex virus 1 infection
pps05169  Epstein-Barr virus infection
pps05310  Asthma
pps05320  Autoimmune thyroid disease
pps05321  Inflammatory bowel disease
pps05322  Systemic lupus erythematosus
pps05323  Rheumatoid arthritis
pps05330  Allograft rejection
pps05332  Graft-versus-host disease
pps05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:pps00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    100986750
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    100986750
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    100986750
   04612 Antigen processing and presentation
    100986750
   04658 Th1 and Th2 cell differentiation
    100986750
   04659 Th17 cell differentiation
    100986750
   04672 Intestinal immune network for IgA production
    100986750
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100986750
   05164 Influenza A
    100986750
   05168 Herpes simplex virus 1 infection
    100986750
   05169 Epstein-Barr virus infection
    100986750
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    100986750
   05152 Tuberculosis
    100986750
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100986750
   05140 Leishmaniasis
    100986750
  09163 Immune disease
   05310 Asthma
    100986750
   05322 Systemic lupus erythematosus
    100986750
   05323 Rheumatoid arthritis
    100986750
   05320 Autoimmune thyroid disease
    100986750
   05321 Inflammatory bowel disease
    100986750
   05330 Allograft rejection
    100986750
   05332 Graft-versus-host disease
    100986750
  09166 Cardiovascular disease
   05416 Viral myocarditis
    100986750
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    100986750
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pps04147]
    100986750
Exosome [BR:pps04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100986750
  Exosomal proteins of epithelial cells
   100986750
  Exosomal proteins of breast milk
   100986750
SSDB
Motif
Pfam: MHC_II_beta C1-set Ig_3 ig Ig_2 MHC_I DUF202 I-set
Other DBs
NCBI-GeneID: 100986750
NCBI-ProteinID: XP_003829806
Position
6
AA seq 266 aa
MVCLKLPGGSCMAALTVTLMVLSSPLALAGDTRSRFLELVKSECHFFNGTERVRFLERYF
YNQEEYVRFDSDVGEYRAVTELGRPDAEYWNSQKDYVEQKRGQVDNYCRHNYRVGESFTV
QRRVHPQVTVYPAKTQPLQHHNLLVCSVNGFYPGSIEVRWFRNGQEEKAGVVSTGLIQNG
DWTFQTLVMLETVPRSGEVYTCQVEHPSVTSPLTVEWRARSESAQSKMLSGVGGFVLGLL
FLGAGLFIYFRNQKGHSGLQPTGFLS
NT seq 801 nt   +upstreamnt  +downstreamnt
atggtgtgtttgaagctccctggaggctcctgcatggcagcgctgacagtgacactgatg
gtgctgagctccccactggctttggctggggacacccgatcacgtttcttggagctggtt
aagtctgagtgtcatttcttcaatgggacggagcgggtgcggttcctggagagatacttc
tataaccaggaggagtacgtgcgcttcgacagcgacgtgggggagtaccgggcggtgacg
gagctggggcggcctgatgccgagtactggaacagccagaaggactacgtggagcagaag
cggggccaggtggacaattactgcagacacaactacagggttggtgagagcttcacagtg
cagcggcgagtccatcctcaggtgactgtgtatcctgcaaagacccagcccctgcagcac
cacaacctcctggtctgctctgtgaatggtttctatccaggcagcattgaagtcaggtgg
ttccggaatggccaggaagagaaggctggggtggtgtccacgggcctgatccagaatgga
gactggaccttccagaccctggtgatgctagaaacagttcctcggagtggagaggtttac
acctgccaagtggagcacccaagcgtaacgagccctctcacagtggaatggagagcacgg
tctgaatctgcacagagcaagatgctgagtggagtcgggggctttgtgctgggcctgctc
ttccttggggccgggctgttcatctacttcaggaatcagaaaggacactctggacttcag
ccaacaggattcctgagctga

KEGG   Pan paniscus (bonobo): 100987081
Entry
100987081         CDS       T02283                                 

Definition
(RefSeq) HLA class II histocompatibility antigen, DR alpha chain
  KO
K06752  MHC class II antigen
Organism
pps  Pan paniscus (bonobo)
Pathway
pps04145  Phagosome
pps04514  Cell adhesion molecules
pps04612  Antigen processing and presentation
pps04640  Hematopoietic cell lineage
pps04658  Th1 and Th2 cell differentiation
pps04659  Th17 cell differentiation
pps04672  Intestinal immune network for IgA production
pps04940  Type I diabetes mellitus
pps05140  Leishmaniasis
pps05145  Toxoplasmosis
pps05150  Staphylococcus aureus infection
pps05152  Tuberculosis
pps05164  Influenza A
pps05166  Human T-cell leukemia virus 1 infection
pps05168  Herpes simplex virus 1 infection
pps05169  Epstein-Barr virus infection
pps05310  Asthma
pps05320  Autoimmune thyroid disease
pps05321  Inflammatory bowel disease
pps05322  Systemic lupus erythematosus
pps05323  Rheumatoid arthritis
pps05330  Allograft rejection
pps05332  Graft-versus-host disease
pps05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:pps00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    100987081
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    100987081
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    100987081
   04612 Antigen processing and presentation
    100987081
   04658 Th1 and Th2 cell differentiation
    100987081
   04659 Th17 cell differentiation
    100987081
   04672 Intestinal immune network for IgA production
    100987081
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100987081
   05164 Influenza A
    100987081
   05168 Herpes simplex virus 1 infection
    100987081
   05169 Epstein-Barr virus infection
    100987081
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    100987081
   05152 Tuberculosis
    100987081
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100987081
   05140 Leishmaniasis
    100987081
  09163 Immune disease
   05310 Asthma
    100987081
   05322 Systemic lupus erythematosus
    100987081
   05323 Rheumatoid arthritis
    100987081
   05320 Autoimmune thyroid disease
    100987081
   05321 Inflammatory bowel disease
    100987081
   05330 Allograft rejection
    100987081
   05332 Graft-versus-host disease
    100987081
  09166 Cardiovascular disease
   05416 Viral myocarditis
    100987081
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    100987081
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pps04147]
    100987081
Exosome [BR:pps04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100987081
  Exosomal proteins of epithelial cells
   100987081
  Exosomal proteins of breast milk
   100987081
SSDB
Motif
Pfam: MHC_II_alpha C1-set Marek_A Ig_3 C2-set_2
Other DBs
NCBI-GeneID: 100987081
NCBI-ProteinID: XP_003829807
UniProt: A0A2R9C8E3
Position
6
AA seq 254 aa
MAVSGVPVLGFFIIAVLMSAQESWAIKEEHVIIQAEFYLNPDQSGEFMFDFDGDEIFHVD
MAKKETVWRLEEFGRFASFEAQGALANIAVDKANLEIMTKRSNYTPITNVPPEVTVLTNS
PVELREPNILICFIDKFTPPVVNVTWLRNGKPVTTGVSETVFLPREDHLFRKFHYLPFLP
STEDVYDCRVEHWGLDEPLLKHWEFDAPSPLPETTENVVCALGLTVGLVGIIIGTIFIIK
GVRKSNAAERRGPL
NT seq 765 nt   +upstreamnt  +downstreamnt
atggccgtaagtggagtccctgtgctaggatttttcatcatagctgtgctgatgagcgct
caggaatcatgggctatcaaagaagaacatgtgatcatccaggccgagttctatctgaat
cctgaccaatcaggcgagtttatgtttgactttgatggtgatgagattttccacgtggat
atggcaaagaaggagacggtctggcggcttgaagaatttggacgatttgccagctttgag
gctcaaggtgcattggccaacatagctgtggacaaagccaacctggaaatcatgacaaag
cgctccaactatactccgatcaccaatgtacctccagaggtaactgtgctcacaaacagc
cctgtggaactgagagagcccaacatcctcatctgtttcatcgacaagttcaccccacca
gtggtcaatgtcacgtggcttcgaaatggaaaacctgtcaccacaggagtgtcagagaca
gtcttcctgcccagggaagaccaccttttccgcaagttccactatctccccttcctgccc
tcaactgaggacgtttacgactgcagggtggaacactggggcttggatgagcctcttctc
aagcactgggagtttgatgctccaagccctctcccagagactacagagaatgtggtgtgt
gccctgggcctgactgtgggtctggtgggcatcattattgggaccatcttcatcatcaag
ggagtgcgcaaaagcaatgcagcagaacgcagggggcctctgtaa

KEGG   Pan paniscus (bonobo): 100987433
Entry
100987433         CDS       T02283                                 

Definition
(RefSeq) HLA class II histocompatibility antigen, DRB1-10 beta chain-like
  KO
K06752  MHC class II antigen
Organism
pps  Pan paniscus (bonobo)
Pathway
pps04145  Phagosome
pps04514  Cell adhesion molecules
pps04612  Antigen processing and presentation
pps04640  Hematopoietic cell lineage
pps04658  Th1 and Th2 cell differentiation
pps04659  Th17 cell differentiation
pps04672  Intestinal immune network for IgA production
pps04940  Type I diabetes mellitus
pps05140  Leishmaniasis
pps05145  Toxoplasmosis
pps05150  Staphylococcus aureus infection
pps05152  Tuberculosis
pps05164  Influenza A
pps05166  Human T-cell leukemia virus 1 infection
pps05168  Herpes simplex virus 1 infection
pps05169  Epstein-Barr virus infection
pps05310  Asthma
pps05320  Autoimmune thyroid disease
pps05321  Inflammatory bowel disease
pps05322  Systemic lupus erythematosus
pps05323  Rheumatoid arthritis
pps05330  Allograft rejection
pps05332  Graft-versus-host disease
pps05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:pps00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    100987433
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    100987433
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    100987433
   04612 Antigen processing and presentation
    100987433
   04658 Th1 and Th2 cell differentiation
    100987433
   04659 Th17 cell differentiation
    100987433
   04672 Intestinal immune network for IgA production
    100987433
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100987433
   05164 Influenza A
    100987433
   05168 Herpes simplex virus 1 infection
    100987433
   05169 Epstein-Barr virus infection
    100987433
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    100987433
   05152 Tuberculosis
    100987433
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100987433
   05140 Leishmaniasis
    100987433
  09163 Immune disease
   05310 Asthma
    100987433
   05322 Systemic lupus erythematosus
    100987433
   05323 Rheumatoid arthritis
    100987433
   05320 Autoimmune thyroid disease
    100987433
   05321 Inflammatory bowel disease
    100987433
   05330 Allograft rejection
    100987433
   05332 Graft-versus-host disease
    100987433
  09166 Cardiovascular disease
   05416 Viral myocarditis
    100987433
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    100987433
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pps04147]
    100987433
Exosome [BR:pps04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100987433
  Exosomal proteins of epithelial cells
   100987433
  Exosomal proteins of breast milk
   100987433
SSDB
Motif
Pfam: MHC_II_beta C1-set Ig_3 ig Ig_2 C2-set_2
Other DBs
NCBI-GeneID: 100987433
NCBI-ProteinID: XP_014200798
Position
6
AA seq 278 aa
MVCLRLPGGSCMAVLTVTLMVLSSPLALAGDTRPRFLEEVKFECHFFNGTERVRFLERRV
HNQEEYARYDSDVGEYRAVTELGRPDAEYWNSQKDLLAQRRAAVDTXXXXXXXLLCLPDS
FLLPFFLLVHPQVTVYPSKTQPLQHHNLLVCSVSSFYPGSIEVRWFRNGQEEKTGVVSTG
LIQNGDWTFQTLVMLETVPQSGEVYTCQVEHPSVMSPLTVEWRARSESAQSKMLSGVGGF
VLGLLFLGAGLXXXXXXXFIYFRNQKGHSGLPPTGFLS
NT seq 837 nt   +upstreamnt  +downstreamnt
atggtgtgtctgaggctccctggaggctcctgcatggcagttctgacagtgacactgatg
gtgctgagctccccactggctttggctggggacaccagaccacgtttcttggaggaggtt
aagtttgagtgtcatttcttcaacgggacggagcgggtgcggttcctggagagacgcgtc
cataaccaagaggagtacgcgcgctacgacagcgacgtgggggagtaccgggcggtgacg
gagctggggcggcctgacgccgagtactggaacagccagaaggacctcctggcgcagagg
cgggccgcggtggacacnnnnnnnnnnnnnnnnnnnnacttactctgtcttcctgactca
ttccttctacctttttttctcctagtccatcctcaggtaactgtgtatccttcaaagacc
cagcccctgcagcaccacaacctcctggtctgctctgtgagtagtttctatccaggcagc
attgaagtcaggtggttccggaacggccaggaagagaagactggggtggtgtccacaggc
ctgatccagaatggagactggaccttccagaccctggtgatgctggaaacagttcctcag
agtggagaggtttacacctgccaagtggagcacccaagtgtgatgagccctctcacagtg
gaatggagagcacggtctgaatctgcacagagcaagatgctgagtggagtcgggggcttt
gtgctgggcctgctcttccttggggccgggctgnnnnnnnnnnnnnnnnnnnngttcatc
tacttcagaaatcagaaaggacactctggacttccgccaacaggattcctgagctga

KEGG   Pan paniscus (bonobo): 100993508
Entry
100993508         CDS       T02283                                 

Definition
(RefSeq) HLA class II histocompatibility antigen, DQ alpha 1 chain
  KO
K06752  MHC class II antigen
Organism
pps  Pan paniscus (bonobo)
Pathway
pps04145  Phagosome
pps04514  Cell adhesion molecules
pps04612  Antigen processing and presentation
pps04640  Hematopoietic cell lineage
pps04658  Th1 and Th2 cell differentiation
pps04659  Th17 cell differentiation
pps04672  Intestinal immune network for IgA production
pps04940  Type I diabetes mellitus
pps05140  Leishmaniasis
pps05145  Toxoplasmosis
pps05150  Staphylococcus aureus infection
pps05152  Tuberculosis
pps05164  Influenza A
pps05166  Human T-cell leukemia virus 1 infection
pps05168  Herpes simplex virus 1 infection
pps05169  Epstein-Barr virus infection
pps05310  Asthma
pps05320  Autoimmune thyroid disease
pps05321  Inflammatory bowel disease
pps05322  Systemic lupus erythematosus
pps05323  Rheumatoid arthritis
pps05330  Allograft rejection
pps05332  Graft-versus-host disease
pps05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:pps00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    100993508
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    100993508
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    100993508
   04612 Antigen processing and presentation
    100993508
   04658 Th1 and Th2 cell differentiation
    100993508
   04659 Th17 cell differentiation
    100993508
   04672 Intestinal immune network for IgA production
    100993508
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100993508
   05164 Influenza A
    100993508
   05168 Herpes simplex virus 1 infection
    100993508
   05169 Epstein-Barr virus infection
    100993508
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    100993508
   05152 Tuberculosis
    100993508
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100993508
   05140 Leishmaniasis
    100993508
  09163 Immune disease
   05310 Asthma
    100993508
   05322 Systemic lupus erythematosus
    100993508
   05323 Rheumatoid arthritis
    100993508
   05320 Autoimmune thyroid disease
    100993508
   05321 Inflammatory bowel disease
    100993508
   05330 Allograft rejection
    100993508
   05332 Graft-versus-host disease
    100993508
  09166 Cardiovascular disease
   05416 Viral myocarditis
    100993508
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    100993508
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pps04147]
    100993508
Exosome [BR:pps04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100993508
  Exosomal proteins of epithelial cells
   100993508
  Exosomal proteins of breast milk
   100993508
SSDB
Motif
Pfam: MHC_II_alpha C1-set Ig_3 Marek_A C2-set_2 EF_assoc_2
Other DBs
NCBI-GeneID: 100993508
NCBI-ProteinID: XP_008957594
UniProt: A0A2R8ZXF4
Position
Un
AA seq 254 aa
MILNKALMLGALALTTVMSPCGGEDIVADHVASYGVNLYQSYGPSGQFTHEFDGDEQFYV
DLGRKETVWCLPVLRQFRFDPQFALTNIAVLKHNLNSLIKRSNSTAATNEVPEVTVFSKS
PVTLGQPNILICLVDNIFPPVLNVTWLSNGHSVTEGVSETSFLSKSDHSFFKISYLTFLP
SADEIYDCKVEHWGLDQPLLKHWEPEIPAPMSELTETVVCTLGLSVGLVGIVVGTVLIIR
GLRSVGASRHQGPL
NT seq 765 nt   +upstreamnt  +downstreamnt
atgatcctaaacaaagctctgatgctgggggccctcgccctgaccaccgtgatgagcccc
tgtggaggtgaagacattgtggctgaccacgtcgcctcttatggtgtaaacttgtaccag
tcttacggtccctctggccagttcacccatgaatttgatggagacgagcagttctacgtg
gacctggggaggaaggagactgtctggtgtttgcctgttctcagacaatttagatttgac
ccgcaatttgcactgacaaacatcgctgtcctaaaacataacttgaacagtctgattaaa
cgctccaactctaccgctgctaccaatgaggttcctgaggtcacagtgttttccaagtct
cccgtgacactgggtcagcccaacatcctcatctgtcttgtggacaacatctttcctcct
gtgctcaacgtcacatggctgagcaatgggcactcagtcacagaaggtgtttctgagacc
agcttcctctccaagagtgatcattccttcttcaagatcagttacctcaccttcctccct
tctgctgatgagatttatgactgcaaggtggagcactggggcctggaccagcctcttctg
aaacactgggagcctgagattccagcacctatgtcagagctcacagagactgtggtctgc
accctggggttgtctgtgggcctcgtgggcattgtggtggggaccgtcttgatcatccga
ggcctgcgttcagttggtgcttccagacaccaagggcccttgtga

KEGG   Pan paniscus (bonobo): 100993847
Entry
100993847         CDS       T02283                                 

Definition
(RefSeq) HLA class II histocompatibility antigen, DQ beta 1 chain-like
  KO
K06752  MHC class II antigen
Organism
pps  Pan paniscus (bonobo)
Pathway
pps04145  Phagosome
pps04514  Cell adhesion molecules
pps04612  Antigen processing and presentation
pps04640  Hematopoietic cell lineage
pps04658  Th1 and Th2 cell differentiation
pps04659  Th17 cell differentiation
pps04672  Intestinal immune network for IgA production
pps04940  Type I diabetes mellitus
pps05140  Leishmaniasis
pps05145  Toxoplasmosis
pps05150  Staphylococcus aureus infection
pps05152  Tuberculosis
pps05164  Influenza A
pps05166  Human T-cell leukemia virus 1 infection
pps05168  Herpes simplex virus 1 infection
pps05169  Epstein-Barr virus infection
pps05310  Asthma
pps05320  Autoimmune thyroid disease
pps05321  Inflammatory bowel disease
pps05322  Systemic lupus erythematosus
pps05323  Rheumatoid arthritis
pps05330  Allograft rejection
pps05332  Graft-versus-host disease
pps05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:pps00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    100993847
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    100993847
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    100993847
   04612 Antigen processing and presentation
    100993847
   04658 Th1 and Th2 cell differentiation
    100993847
   04659 Th17 cell differentiation
    100993847
   04672 Intestinal immune network for IgA production
    100993847
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100993847
   05164 Influenza A
    100993847
   05168 Herpes simplex virus 1 infection
    100993847
   05169 Epstein-Barr virus infection
    100993847
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    100993847
   05152 Tuberculosis
    100993847
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100993847
   05140 Leishmaniasis
    100993847
  09163 Immune disease
   05310 Asthma
    100993847
   05322 Systemic lupus erythematosus
    100993847
   05323 Rheumatoid arthritis
    100993847
   05320 Autoimmune thyroid disease
    100993847
   05321 Inflammatory bowel disease
    100993847
   05330 Allograft rejection
    100993847
   05332 Graft-versus-host disease
    100993847
  09166 Cardiovascular disease
   05416 Viral myocarditis
    100993847
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    100993847
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pps04147]
    100993847
Exosome [BR:pps04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100993847
  Exosomal proteins of epithelial cells
   100993847
  Exosomal proteins of breast milk
   100993847
SSDB
Motif
Pfam: MHC_II_beta C1-set Ig_3 C2-set_2 ig MHC_I
Other DBs
NCBI-GeneID: 100993847
NCBI-ProteinID: XP_008957596
Position
Un
AA seq 241 aa
MLAMLSXPVAEGRDSPEDFVYQFKGMCYFTNGTERVWSVDRYIYNREEFVRFDSDVGEYR
AVTPLGRPDAEYWNSQKEALERKRAELDTVCIHNYQLELRTTLQRRVEPTVTISPSRTEA
LNHHNLLVCSVTDFYPAQIKVRWFRNDQEETAGIVSTPLIRNGDWTFQILVMLEMTPQRG
DVYTCHVEHPSLQSPITVEWRAQSESAQSKMLSGIGGFVLGLIFLGLGLIIHHRSQKGLL
H
NT seq 726 nt   +upstreamnt  +downstreamnt
atgctggcgatgctgagcnacccagtggctgaggggagagactctcccgaggatttcgtg
taccagtttaagggcatgtgctacttcaccaacgggacagagcgcgtgtggagtgtagac
agatacatctataacagagaggagttcgtgcgcttcgacagcgacgtgggggagtaccgg
gcggtgacgccactggggcggcctgatgccgagtactggaacagccagaaggaagccctg
gagaggaaacgggcggagttggacacggtgtgcatacacaactaccagttggaactccgc
acgaccttgcagcggcgagtggagcccacagtgaccatctccccatccaggacagaggcc
ctcaaccaccacaacctgctggtctgctcggtgacagatttctatccagcccagatcaaa
gtccggtggtttcggaatgaccaggaggagacagccggcattgtgtccacccccctcatt
aggaacggtgactggaccttccagatcctggtgatgctggaaatgactccccagcgtgga
gacgtctacacctgccacgtggagcaccccagcctccagagccccatcaccgtggagtgg
cgggctcaatctgaatctgcccagagcaagatgctgagtggcattggaggcttcgtgctg
gggctgatcttcctcgggctgggccttatcatccatcacaggagtcagaaagggctcctg
cactga

KEGG   Pan paniscus (bonobo): 100995226
Entry
100995226         CDS       T02283                                 

Gene name
Papa-DPB1
Definition
(RefSeq) HLA class II histocompatibility antigen, DP beta 1 chain
  KO
K06752  MHC class II antigen
Organism
pps  Pan paniscus (bonobo)
Pathway
pps04145  Phagosome
pps04514  Cell adhesion molecules
pps04612  Antigen processing and presentation
pps04640  Hematopoietic cell lineage
pps04658  Th1 and Th2 cell differentiation
pps04659  Th17 cell differentiation
pps04672  Intestinal immune network for IgA production
pps04940  Type I diabetes mellitus
pps05140  Leishmaniasis
pps05145  Toxoplasmosis
pps05150  Staphylococcus aureus infection
pps05152  Tuberculosis
pps05164  Influenza A
pps05166  Human T-cell leukemia virus 1 infection
pps05168  Herpes simplex virus 1 infection
pps05169  Epstein-Barr virus infection
pps05310  Asthma
pps05320  Autoimmune thyroid disease
pps05321  Inflammatory bowel disease
pps05322  Systemic lupus erythematosus
pps05323  Rheumatoid arthritis
pps05330  Allograft rejection
pps05332  Graft-versus-host disease
pps05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:pps00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    100995226 (Papa-DPB1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    100995226 (Papa-DPB1)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    100995226 (Papa-DPB1)
   04612 Antigen processing and presentation
    100995226 (Papa-DPB1)
   04658 Th1 and Th2 cell differentiation
    100995226 (Papa-DPB1)
   04659 Th17 cell differentiation
    100995226 (Papa-DPB1)
   04672 Intestinal immune network for IgA production
    100995226 (Papa-DPB1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100995226 (Papa-DPB1)
   05164 Influenza A
    100995226 (Papa-DPB1)
   05168 Herpes simplex virus 1 infection
    100995226 (Papa-DPB1)
   05169 Epstein-Barr virus infection
    100995226 (Papa-DPB1)
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    100995226 (Papa-DPB1)
   05152 Tuberculosis
    100995226 (Papa-DPB1)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100995226 (Papa-DPB1)
   05140 Leishmaniasis
    100995226 (Papa-DPB1)
  09163 Immune disease
   05310 Asthma
    100995226 (Papa-DPB1)
   05322 Systemic lupus erythematosus
    100995226 (Papa-DPB1)
   05323 Rheumatoid arthritis
    100995226 (Papa-DPB1)
   05320 Autoimmune thyroid disease
    100995226 (Papa-DPB1)
   05321 Inflammatory bowel disease
    100995226 (Papa-DPB1)
   05330 Allograft rejection
    100995226 (Papa-DPB1)
   05332 Graft-versus-host disease
    100995226 (Papa-DPB1)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    100995226 (Papa-DPB1)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    100995226 (Papa-DPB1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pps04147]
    100995226 (Papa-DPB1)
Exosome [BR:pps04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100995226 (Papa-DPB1)
  Exosomal proteins of epithelial cells
   100995226 (Papa-DPB1)
  Exosomal proteins of breast milk
   100995226 (Papa-DPB1)
SSDB
Motif
Pfam: MHC_II_beta C1-set Ig_3 Marek_A ig C2-set_2
Other DBs
NCBI-GeneID: 100995226
NCBI-ProteinID: XP_003808643
UniProt: A0A2R9CGS3
Position
6
AA seq 258 aa
MMVLQVSAASRTVALTALMMVLLTSVVQGRATPENYLYQGRQECYAFNGTQRFLERYIYN
REEYARFDSDVGEFRAVTELGRPAAEYWNSQKDFLEEKRAVPDRMCRHNYELVEAVTLQR
RVQPKVNVSPSKKGPLQHHNLLVCHVTDFYPGSIQVRWFLNGQEETAGVVSTNLIRNGDW
TFQILVMLEMTPQQGDVYICQVEHTSLDSPVTVEWKAQSDSARSKTLTGAGGFVLGLIIC
GVGIFMHRRSKKVQRGSA
NT seq 777 nt   +upstreamnt  +downstreamnt
atgatggttctgcaggtttctgcggcctcccggacagtggctctgacggcgttaatgatg
gtgctgctcacgtctgtggtccagggcagggccactccagagaattacctgtaccaggga
cggcaggaatgctacgcgtttaatgggacacagcgcttcctggagagatacatctacaac
cgggaggagtacgcgcgcttcgacagcgacgtgggggagttccgggcggtgacggagctg
gggcggcctgctgcggagtactggaacagccagaaggacttcctggaggagaagcgggca
gtgccggacaggatgtgcagacacaactacgagctggtcgaggccgtgaccctgcagcgc
cgagtccagcctaaggtgaacgtttccccctccaagaaggggcccctgcagcaccacaac
ctgcttgtctgccacgtgacagatttctacccaggcagcattcaagtccgatggttcctg
aatggacaggaggaaacagctggggtcgtgtccaccaacctgatccgtaatggagactgg
accttccagatcctggtgatgctggaaatgaccccccagcagggagacgtctacatctgc
caagtggagcacaccagcctggacagtcctgtcaccgtggagtggaaggcacagtctgat
tctgcccgaagtaagacattgacgggagctgggggcttcgtgctggggctcatcatctgt
ggagtgggcatcttcatgcacaggaggagcaagaaagttcaacgaggatctgcataa

KEGG   Pan paniscus (bonobo): 100995577
Entry
100995577         CDS       T02283                                 

Definition
(RefSeq) HLA class II histocompatibility antigen, DP alpha 1 chain
  KO
K06752  MHC class II antigen
Organism
pps  Pan paniscus (bonobo)
Pathway
pps04145  Phagosome
pps04514  Cell adhesion molecules
pps04612  Antigen processing and presentation
pps04640  Hematopoietic cell lineage
pps04658  Th1 and Th2 cell differentiation
pps04659  Th17 cell differentiation
pps04672  Intestinal immune network for IgA production
pps04940  Type I diabetes mellitus
pps05140  Leishmaniasis
pps05145  Toxoplasmosis
pps05150  Staphylococcus aureus infection
pps05152  Tuberculosis
pps05164  Influenza A
pps05166  Human T-cell leukemia virus 1 infection
pps05168  Herpes simplex virus 1 infection
pps05169  Epstein-Barr virus infection
pps05310  Asthma
pps05320  Autoimmune thyroid disease
pps05321  Inflammatory bowel disease
pps05322  Systemic lupus erythematosus
pps05323  Rheumatoid arthritis
pps05330  Allograft rejection
pps05332  Graft-versus-host disease
pps05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:pps00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    100995577
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    100995577
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    100995577
   04612 Antigen processing and presentation
    100995577
   04658 Th1 and Th2 cell differentiation
    100995577
   04659 Th17 cell differentiation
    100995577
   04672 Intestinal immune network for IgA production
    100995577
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100995577
   05164 Influenza A
    100995577
   05168 Herpes simplex virus 1 infection
    100995577
   05169 Epstein-Barr virus infection
    100995577
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    100995577
   05152 Tuberculosis
    100995577
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100995577
   05140 Leishmaniasis
    100995577
  09163 Immune disease
   05310 Asthma
    100995577
   05322 Systemic lupus erythematosus
    100995577
   05323 Rheumatoid arthritis
    100995577
   05320 Autoimmune thyroid disease
    100995577
   05321 Inflammatory bowel disease
    100995577
   05330 Allograft rejection
    100995577
   05332 Graft-versus-host disease
    100995577
  09166 Cardiovascular disease
   05416 Viral myocarditis
    100995577
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    100995577
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pps04147]
    100995577
Exosome [BR:pps04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100995577
  Exosomal proteins of epithelial cells
   100995577
  Exosomal proteins of breast milk
   100995577
SSDB
Motif
Pfam: MHC_II_alpha C1-set Ig_3 Marek_A
Other DBs
NCBI-GeneID: 100995577
NCBI-ProteinID: XP_003808645
UniProt: A0A2R9AKD7
Position
6
AA seq 260 aa
MRPEDRMFHIRAVIFRALSLAFLLSLRGAGAIKADHVSTYAAFVQTHRPTGEFMFEFDED
EMFYVDLDKKETVWHLEEFGRAFSFEAQGGLANIAILNNNLNILIQRSNHTQAANDPPEV
TVFPKEPVELGQPNTLICHIDKFFPPVLNVTWLCNGEPVTEGVAESLFLPRTDYSFHKFH
YLTFVPSAEDFYDCKVEHWGLDQPLLKHWEAQEPIQMPETRETVLCALGLVLGLVGIIVG
TILIIKSLRSGRDPRAQGPL
NT seq 783 nt   +upstreamnt  +downstreamnt
atgcgccctgaagacagaatgttccatatcagagctgtgatcttcagggccctctccttg
gctttcctgctgagtctccgaggagctggggccatcaaggcggaccatgtgtcaacttat
gccgcgtttgtacagacccatagaccaacaggggagtttatgtttgaatttgatgaagat
gagatgttctatgtggatctggacaagaaggagaccgtctggcatctggaggagtttggc
cgagccttttcctttgaggctcagggcgggctggctaacattgctatattgaacaacaac
ttgaatatcttgatccagcgttccaaccacactcaggccgccaatgatccccctgaggtg
accgtgtttcccaaggagcctgtggagctgggccagcccaacaccctcatctgccacatt
gacaagttcttcccaccagtgctcaacgtcacgtggctgtgcaacggggagccggtcact
gagggtgtcgctgagagcctcttcctgcccagaacagattacagcttccacaagttccac
tacctgacctttgtgccctcagcagaggacttctatgactgcaaggtggagcactggggc
ttggaccagccgctcctcaagcactgggaggcccaagagccaatccagatgcctgagaca
agggagactgtgctctgtgccctgggcctggtgctgggcctagtgggcatcatcgtgggc
accatcctcatcataaagtctctgcgttctggccgtgacccccgggcccaggggcccctg
tga

DBGET integrated database retrieval system