KEGG   Pan paniscus (bonobo): 100967410
Entry
100967410         CDS       T02283                                 

Gene name
AKR1B15
Definition
(RefSeq) aldo-keto reductase family 1 member B15
  KO
K00011  aldehyde reductase [EC:1.1.1.21]
Organism
pps  Pan paniscus (bonobo)
Pathway
pps00040  Pentose and glucuronate interconversions
pps00051  Fructose and mannose metabolism
pps00052  Galactose metabolism
pps00561  Glycerolipid metabolism
pps00790  Folate biosynthesis
pps01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pps00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    100967410 (AKR1B15)
   00051 Fructose and mannose metabolism
    100967410 (AKR1B15)
   00052 Galactose metabolism
    100967410 (AKR1B15)
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    100967410 (AKR1B15)
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    100967410 (AKR1B15)
Enzymes [BR:pps01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.21  aldose reductase
     100967410 (AKR1B15)
SSDB
Motif
Pfam: Aldo_ket_red
Other DBs
NCBI-GeneID: 100967410
NCBI-ProteinID: XP_003813497
UniProt: A0A2R8ZXU1
Position
7
AA seq 344 aa
MVLQMEPQVNSTNNFHRRPLDQPVGPLTGLKSSLLKDTTTAGPLLHPYPASLLGKVKEAV
KVAIDAEYRHIDCAYFYENQHEVGEAIQEKIQEKTVKREDLFIVSKVWPTFFERPLVRKA
FEKTLKDLKLSYLDVYLIHWPQGFKTGDDFFPKDDKGNMISGKGTFLDAWEAMEELVDEG
LVKALGVSNFNHSQIERLLNKRGLKYKPVTNQVECHPYLTQEKLIQYCHSKGITVTAYSP
LGSPDRPWAKPEDPSLLEDPKIKEIAAKHKKTTAQVLIRFHIQRNVTVIPKSMTPAHIVE
NIQVFDFKLSDEEMATILSFNRNWRAFDFKEFSHLEDFPFDAEY
NT seq 1035 nt   +upstreamnt  +downstreamnt
atggtcttacaaatggaaccccaagtgaactcaactaacaacttccaccgaagacccctg
gaccaacccgttggccctttgactggcctaaagagttcccttctgaaggacactacaact
gcagggccccttcttcacccctatccagcatctcttctcggcaaagtgaaagaagcagtg
aaggtggccattgatgcagaatatcgccacattgactgtgcctatttctatgagaatcaa
catgaggtgggagaagccatccaagagaagatccaagagaagactgtgaagcgggaggac
ctgttcatcgtcagcaaggtgtggcccactttctttgagagaccccttgtgaggaaagcc
tttgagaagaccctcaaggacctgaagctgagctatctggacgtctatcttattcactgg
ccacagggattcaagactggggatgactttttccccaaagatgataaaggtaatatgatc
agtggaaaaggaacgttcttggatgcctgggaggccatggaggagctggtggatgagggg
ctggtgaaagcccttggggtctccaatttcaaccactcccagatcgagaggctcttgaac
aaacgtggactgaaatataaaccagtgactaaccaggttgagtgtcacccatacctcacg
caggagaaactgatccagtactgccactccaagggcatcaccgttacggcctacagcccc
ctgggctctccggatagaccttgggccaaaccagaggacccttccctgctggaggatccc
aagattaaggagattgctgcaaagcacaaaaaaaccacagcccaggttctgatccgtttc
catatccagaggaatgtgacagtgatccccaagtctatgacaccagcacacattgttgag
aacattcaggtctttgactttaaattgagtgatgaggagatggcaaccatactcagcttc
aacagaaactggagggcctttgacttcaaggaattctctcatttggaggactttcccttc
gatgcagaatattga

DBGET integrated database retrieval system