KEGG   Pan paniscus (bonobo): 100967581Help
Entry
100967581         CDS       T02283                                 

Gene name
DOCK8
Definition
(RefSeq) dedicator of cytokinesis 8
  KO
K21852  dedicator of cytokinesis protein 6/7/8
Organism
pps  Pan paniscus (bonobo)
Brite
KEGG Orthology (KO) [BR:pps00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:pps04131]
    100967581 (DOCK8)
Membrane trafficking [BR:pps04131]
 Others
  Rho GTPase associated proteins
   Rho guanine nucleotide exchange factors (GEFs)
    100967581 (DOCK8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DHR-2 DOCK-C2 DUF3398 DOCK_N
Motif
Other DBs
NCBI-GeneID: 100967581
NCBI-ProteinID: XP_008961641
Position
9
AA seq 2031 aa AA seqDB search
MTHLNSLDVQLAQELGDFTDDDLDVVFTPKECRTLQPSLPEEGVELDPHVRDCVQTYIRE
WLIVNRKNQGSPEICGFKKTGSRKDFHKTLPKQTFESETLECSEPAAQAGPRHLNVLCDV
SGKGPVTACDFDLRSLQPDKRLENLLQQVSAEDFEKQNEEARRTNRQAELFALYPSVDEE
DAVEIRPVPECPKEHLGNRILVKLLTLKFEIDIEPLFASIALYDVKERKKISENFHCDLN
SDQFKGFLRAHTPSVAASSQARSAVFSVTFPSSDIYLVVKIEKVLQQGEIGDCAEPYTVI
KESDGGKSKEKIEKLKLQAESFCQRLGKYRMPFAWAPISLSSFFNVSTLEREVTDVDSVV
GRSSVGERRTLAQSRRLSERALSLEENGVGSNFKTSTLSVSSFFKQEGDRLSDEDLFKFL
ADYKRSSSLQRRVKSIPGLLRLEISTAPEIINCCLTPEMLPVKPFPENRTRPHKEILEFP
TREVYVPHTVYRNLLYVYPQRLNFVNKLASARNITIKIQFMCGEDASNAMPVIFGKSSGP
EFLQEVYTAVTYHNKSPDFYEEVKIKLPAKLTVNHHLLFTFYHISCQQKQGASVETLLGY
SWLPILLNERLQTGSYCLPVALEKLPPNYSMHSAEKVPLQNPPIKWAEGHKGVFNIEVQA
VSSVHTQDNHLEKFFTLCHSLESQVTFPIRVLDQKISEMGLEHELKLSIICLNSSRLEPL
VLFLHLVLDKLFQLSVQPMVIAGQTANFSQFAFESVVAIANSLHNSKDLSKDQHGRNCLL
ASYVHYVFRLPEVQRDVPKSGAPTALPDPRSYHTYGRTSAAAVSSKLLQARVISSSNPDL
AGTHSAADEEVKNIMSSKIADRNCSRMSYYCSGNNDAPSSTAAPRPASKKHFHEELALQM
VVSTGMVRETVFKYAWFFFELLVKSMAQHVHNMDKRDSFRRTRFSDRFMDDITTIVNVVT
SEIAALLVKPQKENEQAEKMNISLAFFLYDLLSLMDRGFVFNLIKHYCNQLSAKLSNLPT
LVSMRLEFLRILCSHEHYLNLNLFFMNADAAPTSPCPSISSQNSSSCSSFQDQKIASMFD
LTSEYRQQHFLTGLLFTELAAALDAEGEGISKVQRKAVSAVHSLLSSHDLDPRCVKPEVK
VKIAALYLPLVGIILDALPQLCDFTVADTRRYRTSGSDEEQEGAGAINQNVALAIAGNNF
NLKTSGIVLSSLPYKQYNMLNADTTRNLMICFLWIMKNADQSLIRKWIADLPSTQLNRIL
DLLFICVLCFEYKGKQSSDKVSTQVLQKSRDVKARLEEALLRGEGARGEMMRRRAPGNDR
FPGLNENLRWKKEQTHWRQANEKLDKTKAELDQEALISGNLATEAHLIILDMQENIIQAS
SALDCKDSLLGGVLRVLVNSLNCDQSTTYLTHCFATLRALIAKFGDLLFEEEVEQCFDLC
HQVLHHCSSSMDVTRSQACATLYLLMRFSFGATSNFARVKMQVTMSLASLVGRAPDFNEE
HLRRSLRTILAYSEEDTAMQMTPFPTQVEELLCNLNSILYDTVKMREFQEDPEMLMDLMY
RIAKSYQASPDLRLTWLQNMAEKHTKKKCYTEAAMCLVHAAALVAEYLSMLEDHSYLPVG
SVSFQNISSNVLEESVVSDDTLSPDEDGVCAGQYFTESGLVGLLEQAAELFSTGGLYETV
NEVYKLVIPILEAHREFRKLTLTHSKLQRAFDSIVNKDHKRMFGTYFRVGFFGSKFGDLD
EQEFVYKEPAITKLPEISHRLEAFYGQCFGAEFVEVIKDSTPVDKTKLDPNKAYIQITFV
EPYFDEYEMKDRVTYFEKNFNLRRFMYTTPFTLEGRPRGELHEQYRRNTVLTTMHAFPYI
KTRISVIQKEEFVLTPIEVAIEDMKKKTLQLAVAINQEPPDPKMLQMVLQGSVGATVNQG
PLEVAQVFLAEIPADPKLYRHHNKLRLCFKEFIMRCGEAVEKNKRLITADQREYQQELKK
NYNKLKENLRPMIERKIPELYKPIFRVESQKRDSFHRSSFRKCETQLSQGS
NT seq 6096 nt NT seq  +upstreamnt  +downstreamnt
atgacacacctgaacagcctggatgtgcagcttgcccaggagcttggggacttcactgat
gatgacttggacgtggtgttcacgccaaaggaatgtaggactctgcagccctctttgccg
gaggaaggggttgaactggaccctcatgtcagggactgtgttcagacctacatccgtgag
tggctaatcgtgaaccggaaaaaccaaggaagtccagaaatctgtggctttaaaaagact
ggatctcgaaaagattttcacaagacgcttccgaaacagacgtttgagtcggaaaccttg
gagtgcagtgaacccgctgctcaggcaggcccccgccacttaaacgtgctgtgcgacgtg
tctgggaaaggccccgtcactgcctgtgactttgacctccgcagcctgcagcctgacaag
cggctagaaaacctcctgcagcaagtgagcgctgaggactttgagaagcagaacgaggag
gcccggaggaccaacaggcaggccgagctctttgccctttacccatcagtggacgaggag
gatgctgtggaaatacgtccagtaccagaatgtcccaaggaacacctgggcaacagaata
ttggtcaagttgctgaccttgaagttcgagattgacattgagcccctgtttgccagcatt
gccctctacgatgttaaagaaaggaaaaagatctcagaaaattttcactgtgacctgaac
tctgaccagttcaaaggatttctgcgagctcacacgccttcagtggccgcatcaagtcag
gcgagatctgcagtcttctcagtcaccttcccgtcctcagacatctacctggtagtcaag
attgaaaaagtcctgcagcagggagagattggagactgtgcagagccctacacggttatc
aaagaaagtgatggtggaaagagtaaagaaaagattgaaaaactaaaactccaagctgaa
tccttctgccagcgtttggggaaataccggatgccctttgcctgggcacccataagttta
tcaagcttcttcaacgtctccacccttgagagggaggtaactgatgtggactctgtggtt
gggagaagctcagtgggtgaacggaggacactggcccaatctagaaggctttctgaaaga
gccctctccttggaggaaaatggggttggatccaacttcaaaacctccactctgagcgtt
agcagctttttcaagcaggaaggagatcgccttagtgatgaagacttattcaagttttta
gctgactacaaaagatcatcatccttacagagacgagtcaagtcaattccaggcttgctc
agactggagatttctacagctccagagatcatcaattgctgtctgactcctgaaatgctg
cccgtgaaaccctttcctgaaaaccggacacgcccgcacaaagagattttggaatttcca
acacgagaagtatatgtccctcacactgtgtacagaaaccttctctatgtctacccacag
aggctgaactttgtaaacaaactagcatcagcccggaacattaccataaagatccagttt
atgtgtggagaagatgctagcaatgcgatgccggtcatctttggaaagtccagcgggcct
gaatttctgcaggaagtgtacacagctgttacataccataataagtctcctgacttttat
gaagaagtgaaaattaagctccccgcaaagctcacagtaaatcaccacctcctgttcacc
ttctaccatatcagctgtcagcagaagcaaggagcctccgtggaaactctcctgggatat
tcatggctgccaattctcttaaatgaacgtcttcaaactggatcctactgtctcccagtt
gccttggaaaaattgccacccaactactccatgcattccgctgagaaagtcccattacag
aatcctcccattaagtgggctgaaggacataagggagtatttaatattgaagtgcaagct
gtttcttctgtgcacacccaggacaaccacctggagaagttcttcaccctctgccactcc
ctggagagccaggtgaccttccccatccgcgtgctggatcagaaaatcagcgagatgggg
ctggagcatgagctgaagctcagcatcatctgcctgaactcctcccgcctggagccgctc
gtgctcttcctgcacctggtgctggacaagctcttccagctgtccgtgcagcccatggtt
atcgctggccagacagccaacttctcccagtttgccttcgagtccgtggtggccatcgcc
aacagtctgcacaacagcaaggacctgagcaaggaccagcatgggaggaactgcctgctg
gcttcctacgtgcactacgtcttccgcctgccagaggtgcaaagggatgtgcccaagtca
ggcgctcccactgccctcccagaccctcggagctaccacacgtatggccgcacatcagct
gctgctgtgagttcaaagctgctgcaggcccgggtgataagcagcagtaacccagacctc
gcggggacacactccgcagcagacgaggaagtgaagaacatcatgtcttcaaagatcgcc
gatcgcaactgcagccgaatgtcttactattgctctggcaataatgatgctccaagttca
actgcagccccaaggccagccagcaaaaagcatttccatgaggagcttgcccttcagatg
gtggtcagcactggaatggtgagagaaacagtcttcaagtatgcctggttcttctttgag
cttctggtgaaaagcatggcccagcatgtacataacatggacaaacgggacagttttcgg
aggactcgtttttctgaccgtttcatggatgacataactactattgttaatgtggtcacc
tcggaaattgcagcccttttagtaaaaccacagaaggaaaatgaacaggcagaaaagatg
aacatcagcctggctttcttcttgtatgaccttctctccctcatggatcggggctttgtg
tttaacctcatcaaacattattgcaaccagctgtcagccaagctcagtaaccttccaacg
ctcgtttccatgaggctagagttcctgagaatcctctgtagccacgaacactacctcaat
ctcaaccttttttttatgaatgctgatgctgctccaacatctccttgtccttccatatct
tcccagaactcaagctcctgctccagtttccaggaccagaagatcgccagcatgttcgat
ctgacttccgagtaccgccagcagcacttcctcaccgggctcctcttcacagaactggct
gctgccctggatgccgaaggggaaggaatcagcaaagtacaaaggaaagctgtcagtgcc
gttcacagcctgctaagttctcacgacctggacccacgctgtgtcaaaccagaggtgaag
gtcaaaatcgccgccctttacctacctttagtcggcatcattttggatgctttgccacag
ctctgtgactttacagttgcagatactcgcagataccgcaccagtggctcggatgaagaa
caagaaggagccggtgccattaaccagaatgtggctctggccatagcagggaataatttc
aatttgaaaacaagtggaatagtgctgtcttccttgccctataagcagtacaacatgctg
aacgcggacactactcgcaacctcatgatctgcttcctctggatcatgaaaaatgctgat
cagagcctcattaggaagtggattgctgacctgccatcaacgcagctcaacaggatttta
gatctacttttcatctgtgtgttatgttttgagtataagggaaaacagagttctgacaaa
gtcagtacccaagtcctgcagaagtcaagggatgtcaaggcccggctggaagaggctttg
ctccgtggggaaggggccagaggggagatgatgcgccgccgggctccagggaacgaccga
tttccaggcctaaatgaaaatttgagatggaagaaagagcagacacattggcggcaagct
aatgagaagctagataaaacaaaggcagagttagatcaagaagccttgatcagtggcaat
ctggctacagaagcacatttaatcatcctggatatgcaggaaaacattatccaggcgagc
tcggctctggactgtaaagacagcctgctgggaggtgttctgagggtgctggtgaattct
ctgaactgtgatcagagtaccacctacctgactcactgctttgcaacactccgtgctctc
atcgccaagtttggagacttactcttcgaagaggaggtggaacagtgtttcgacctgtgt
caccaagtcctgcaccactgcagcagcagcatggacgtcacccggagccaagcctgtgcc
accctttacctcctcatgaggttcagttttggagccaccagtaattttgcaagagtaaag
atgcaagtaaccatgtccctggcatctttggtgggaagagcaccagactttaatgaagag
cacctgagaagatccttgaggacaattttggcctattcagaagaggacacagccatgcag
atgactccttttcccacccaggtggaggaacttctctgtaatctgaatagcatcttatat
gacacagtgaaaatgagggaatttcaggaagatcctgagatgcttatggatctcatgtac
agaattgccaagagttaccaggcatctcctgatctgcggctgacctggctccagaacatg
gcagagaaacacaccaagaagaagtgctacacggaggctgccatgtgcctggtgcacgcc
gctgcgttagtggctgagtatctgagcatgctggaggaccacagctacctgcccgtgggc
agtgtcagcttccagaatatttcttccaatgtgctggaggagtctgtggtctctgatgac
accctgtcacctgacgaggatggggtgtgtgcaggccagtacttcaccgagagtggcctc
gtgggcctcctggagcaggctgcggagctcttcagcacgggaggcttatatgagacagtt
aatgaggtctacaagctggtcatccccatcctagaagcgcatcgagaattccggaagctg
acactcactcacagcaagctgcagagggccttcgacagcattgttaacaaggatcataag
agaatgtttggaacctacttccgagttggtttctttggatccaaatttggggatttggat
gaacaggaatttgtctacaaagagcctgcaattaccaagcttcctgagatctcacataga
ctagaggcattttatggtcaatgttttggtgcagaatttgtggaagtgattaaagactcc
actcctgtggacaaaaccaagttggatcctaacaaggcctacatacagatcacttttgtg
gagccctactttgatgagtatgagatgaaagacagggtcacatactttgagaagaatttc
aacctccggaggttcatgtacaccaccccgttcaccctggaggggcggcctcggggagag
ctgcatgagcagtacagaaggaacacagtcctgaccactatgcacgccttcccctacatc
aagaccaggatcagcgtcatccagaaggaggagtttgttttgacgccgattgaagttgcc
attgaagacatgaagaagaagaccctgcagttagcggttgccattaaccaggagccgcct
gatccaaagatgcttcagatggtgctgcaaggctctgtgggagccactgtaaatcaggga
ccgctggaagtagcccaagtgtttttggctgaaattcctgctgatccaaaactctatcga
catcacaacaagttgaggttatgctttaaggaattcatcatgagatgtggtgaagctgta
gagaaaaacaagcgtctcatcacggcagaccagagggaatatcagcaggaactcaaaaag
aactataacaagctaaaagagaacctcaggccaatgatcgagcggaaaattccagaactg
tacaagccaatattcagagttgagagtcaaaagagggactccttccacagatctagtttc
aggaaatgtgaaacccagttgtcacagggcagctaa

DBGET integrated database retrieval system