KEGG   Pan paniscus (bonobo): 100967628
Entry
100967628         CDS       T02283                                 

Definition
(RefSeq) C-C motif chemokine 3-like 1
  KO
K05408  C-C motif chemokine 3
Organism
pps  Pan paniscus (bonobo)
Pathway
pps04060  Cytokine-cytokine receptor interaction
pps04061  Viral protein interaction with cytokine and cytokine receptor
pps04062  Chemokine signaling pathway
pps04620  Toll-like receptor signaling pathway
pps05142  Chagas disease
pps05163  Human cytomegalovirus infection
pps05323  Rheumatoid arthritis
pps05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:pps00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100967628
   04061 Viral protein interaction with cytokine and cytokine receptor
    100967628
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    100967628
   04062 Chemokine signaling pathway
    100967628
 09160 Human Diseases
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    100967628
  09174 Infectious disease: parasitic
   05142 Chagas disease
    100967628
  09163 Immune disease
   05323 Rheumatoid arthritis
    100967628
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    100967628
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:pps04052]
    100967628
   00536 Glycosaminoglycan binding proteins [BR:pps00536]
    100967628
Cytokines and growth factors [BR:pps04052]
 Cytokines
  Chemokines
   100967628
Glycosaminoglycan binding proteins [BR:pps00536]
 Heparan sulfate / Heparin
  Chemokines
   100967628
SSDB
Motif
Pfam: IL8
Other DBs
NCBI-GeneID: 100967628
NCBI-ProteinID: XP_003811123
UniProt: A0A2R8ZPZ5
Position
Un
AA seq 93 aa
MQVSTAALAVLLCTVALCNQVLSAPLAADTPTACCFSYISRQIPQNFIADYFETSSQCSK
PGVIFLTKRGRQVCADPSEERVQKYVSDLELSA
NT seq 282 nt   +upstreamnt  +downstreamnt
atgcaggtctccactgctgcccttgccgtcctgctctgcaccgtggctctctgcaaccag
gtcctctctgcaccacttgctgctgacacgccgaccgcctgctgcttcagctatatctcc
cgacagattccacagaatttcatagcggactactttgagaccagcagccagtgctccaag
cccggtgtcatcttcctaaccaagagaggccggcaggtctgtgctgaccccagtgaggag
cgggtccagaaatacgtcagtgacctggagctaagtgcctga

KEGG   Pan paniscus (bonobo): 100992309
Entry
100992309         CDS       T02283                                 

Gene name
CCL3
Definition
(RefSeq) C-C motif chemokine 3
  KO
K05408  C-C motif chemokine 3
Organism
pps  Pan paniscus (bonobo)
Pathway
pps04060  Cytokine-cytokine receptor interaction
pps04061  Viral protein interaction with cytokine and cytokine receptor
pps04062  Chemokine signaling pathway
pps04620  Toll-like receptor signaling pathway
pps05142  Chagas disease
pps05163  Human cytomegalovirus infection
pps05323  Rheumatoid arthritis
pps05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:pps00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100992309 (CCL3)
   04061 Viral protein interaction with cytokine and cytokine receptor
    100992309 (CCL3)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    100992309 (CCL3)
   04062 Chemokine signaling pathway
    100992309 (CCL3)
 09160 Human Diseases
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    100992309 (CCL3)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    100992309 (CCL3)
  09163 Immune disease
   05323 Rheumatoid arthritis
    100992309 (CCL3)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    100992309 (CCL3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:pps04052]
    100992309 (CCL3)
   00536 Glycosaminoglycan binding proteins [BR:pps00536]
    100992309 (CCL3)
Cytokines and growth factors [BR:pps04052]
 Cytokines
  Chemokines
   100992309 (CCL3)
Glycosaminoglycan binding proteins [BR:pps00536]
 Heparan sulfate / Heparin
  Chemokines
   100992309 (CCL3)
SSDB
Motif
Pfam: IL8
Other DBs
NCBI-GeneID: 100992309
NCBI-ProteinID: XP_003818009
UniProt: A0A2R8Z5M7
Position
17
AA seq 92 aa
MQVSTAALAVLLCTMALCNQFSASLAADTPTACCFSYISRQIPQNFIADYFETSSQCSKP
SVIFLTKRGRQVCADPSEEWVQKYVSDLELSA
NT seq 279 nt   +upstreamnt  +downstreamnt
atgcaggtctccactgctgcccttgctgtcctcctctgcaccatggctctctgcaaccag
ttctctgcatcacttgctgctgacacgccgaccgcctgctgcttcagctacatctcccgg
cagattccacagaatttcatagcggactactttgagacgagcagccagtgctccaagccc
agtgtcatcttcctaaccaagagaggccggcaggtctgtgctgaccccagtgaggagtgg
gtccagaaatatgtcagcgacctggagctgagtgcctga

DBGET integrated database retrieval system