KEGG   Pan paniscus (bonobo): 100967832
Entry
100967832         CDS       T02283                                 

Gene name
CD80
Definition
(RefSeq) CD80 molecule
  KO
K05412  CD80 antigen
Organism
pps  Pan paniscus (bonobo)
Pathway
pps04514  Cell adhesion molecules
pps04620  Toll-like receptor signaling pathway
pps04672  Intestinal immune network for IgA production
pps04940  Type I diabetes mellitus
pps05320  Autoimmune thyroid disease
pps05322  Systemic lupus erythematosus
pps05323  Rheumatoid arthritis
pps05330  Allograft rejection
pps05332  Graft-versus-host disease
pps05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:pps00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    100967832 (CD80)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    100967832 (CD80)
   04672 Intestinal immune network for IgA production
    100967832 (CD80)
 09160 Human Diseases
  09163 Immune disease
   05322 Systemic lupus erythematosus
    100967832 (CD80)
   05323 Rheumatoid arthritis
    100967832 (CD80)
   05320 Autoimmune thyroid disease
    100967832 (CD80)
   05330 Allograft rejection
    100967832 (CD80)
   05332 Graft-versus-host disease
    100967832 (CD80)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    100967832 (CD80)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    100967832 (CD80)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:pps04090]
    100967832 (CD80)
CD molecules [BR:pps04090]
 Proteins
  100967832 (CD80)
SSDB
Motif
Pfam: C2-set_2 V-set Ig_3 I-set ig Ig_2 Smim3
Other DBs
NCBI-GeneID: 100967832
NCBI-ProteinID: XP_003825194
UniProt: A0A2R9BU76
Position
3
AA seq 288 aa
MGHTRRQGTSPSKCPYLNFFQLLVLAGLSHFCSGVIHVTKEVKEVATLSCGHNVSVEELA
QTRIYWQKEKKMVLTMMSGDMNIWPEYRNRTIFDITNNLSIVILALRPSDEGTYECVVLK
YEKDAFKREHLAEVTLSVKADFPTPSISDFEIPTSNIRRIICSTSGGFPEPHLSWLENGE
ELNAINTTVSQDPETELYAVSSKLDFNMTTNHSFMCLIKYGHLRVNQTFNWNTTKQEHFP
DNLLPSWAIILISVNGIFVICCLTYCFAPRCRERRRNERLRRESVRPV
NT seq 867 nt   +upstreamnt  +downstreamnt
atgggccacacacggaggcagggaacatcaccatccaagtgtccatacctcaatttcttt
cagctcttggtgctggctggtctttctcacttctgttcaggtgttatccacgtgaccaag
gaagtgaaagaagtggcaacgctgtcctgtggtcacaatgtttctgttgaagagctggca
caaactcgcatctactggcaaaaggagaagaaaatggtgctgactatgatgtctggggac
atgaatatatggcccgagtacaggaaccggaccatctttgatatcactaataacctctcc
attgtgatcctggctctgcgcccatctgatgagggcacatacgagtgtgttgttctgaag
tatgaaaaagacgctttcaagcgggaacacctggctgaagtgacgttatcggtcaaagct
gacttccctacacctagtatatctgactttgaaattccaacttctaatattagaaggata
atttgctcaacctctggaggttttccagagcctcacctctcctggttggaaaatggagaa
gaattaaatgccatcaacacaacagtttcccaagatcctgaaactgagctctatgctgtt
agcagcaaactggatttcaatatgacaaccaaccacagcttcatgtgtctcatcaagtat
ggacatttaagagtgaatcagaccttcaactggaatacaaccaagcaagagcattttcct
gataacctgctcccatcctgggccattatcttaatctcagtaaatggaatttttgtgata
tgctgcctgacctactgttttgccccaagatgcagagagagaaggaggaatgagagattg
agaagggaaagtgtacgccctgtataa

KEGG   Pan paniscus (bonobo): 100981251
Entry
100981251         CDS       T02283                                 

Gene name
CD86
Definition
(RefSeq) CD86 molecule
  KO
K05413  CD86 antigen
Organism
pps  Pan paniscus (bonobo)
Pathway
pps04514  Cell adhesion molecules
pps04620  Toll-like receptor signaling pathway
pps04672  Intestinal immune network for IgA production
pps04940  Type I diabetes mellitus
pps05167  Kaposi sarcoma-associated herpesvirus infection
pps05202  Transcriptional misregulation in cancer
pps05320  Autoimmune thyroid disease
pps05322  Systemic lupus erythematosus
pps05323  Rheumatoid arthritis
pps05330  Allograft rejection
pps05332  Graft-versus-host disease
pps05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:pps00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    100981251 (CD86)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    100981251 (CD86)
   04672 Intestinal immune network for IgA production
    100981251 (CD86)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    100981251 (CD86)
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    100981251 (CD86)
  09163 Immune disease
   05322 Systemic lupus erythematosus
    100981251 (CD86)
   05323 Rheumatoid arthritis
    100981251 (CD86)
   05320 Autoimmune thyroid disease
    100981251 (CD86)
   05330 Allograft rejection
    100981251 (CD86)
   05332 Graft-versus-host disease
    100981251 (CD86)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    100981251 (CD86)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    100981251 (CD86)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pps04147]
    100981251 (CD86)
   04090 CD molecules [BR:pps04090]
    100981251 (CD86)
Exosome [BR:pps04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100981251 (CD86)
CD molecules [BR:pps04090]
 Proteins
  100981251 (CD86)
SSDB
Motif
Pfam: Ig_2 V-set Ig_3 LAX I-set ig C2-set_2 DUF4381
Other DBs
NCBI-GeneID: 100981251
NCBI-ProteinID: XP_003825233
UniProt: A0A2R9AVG5
Position
3
AA seq 329 aa
MDPQCTMGLSNTLFVMAFLLSGAAPLKIQAYFNETADLPCQFANSQNQRLSELVVFWQDQ
ENLVLNEVYLGKEKFDSVHSKYMGRTSFDSDSWTLRLHNLQIKDKGLYQCIIHHKKPTGM
IRIHQMNSELSVLANFSQPEIVPISNITENVYINLTCSSIHGYPEPKKMSVLLRTKNSTI
EYDGVMQKSQDNVTELYDVSISLSVSFPDVTSNMTIFCILETDKTRLLSSPFSIELEDPQ
PPPDHIPWITAVLPTVIICVMVFCLILWKWKKKKRPRNSYKCGTNTMEREESEQTKKREK
IHIPERSDEAQRVFKSSKTSSCDKSDTCF
NT seq 990 nt   +upstreamnt  +downstreamnt
atggatccccagtgcactatgggactgagtaacactctctttgtgatggccttcctgctc
tctggtgctgctcccctgaagattcaagcttatttcaatgagactgcagacctgccatgc
caatttgcaaactctcaaaaccaaagactgagtgagctagtagtattttggcaggaccag
gaaaacttggttctgaatgaggtatacttaggcaaagagaaatttgacagtgttcattcc
aagtatatgggccgcacaagttttgattcggacagttggaccctgagacttcacaatctt
cagatcaaggacaagggcttgtatcaatgtatcatccatcacaaaaagcccacaggaatg
attcgcatccaccagatgaattctgaactgtcagtgcttgctaacttcagtcaacctgaa
atagtaccaatttctaatataacagaaaatgtgtacataaatttgacctgctcatctata
cacggttacccagaacctaagaagatgagtgttttgctaagaaccaagaattcaactatc
gagtatgatggtgttatgcagaaatctcaagataatgtcacagaactgtacgacgtttcc
atcagcttgtctgtttcattccctgatgttacgagcaatatgaccatcttctgtattctg
gaaactgacaagacgcggcttttatcttcacctttctctatagagcttgaggaccctcag
cctcccccagaccacattccttggattacagctgtacttccaacagttattatatgtgtg
atggttttctgtctaattctatggaaatggaagaagaagaagcggcctcgcaactcttat
aaatgtggaaccaacacaatggagagggaagagagtgaacagaccaagaaaagagaaaaa
atccatatacctgaaagatctgatgaagcccagcgtgtttttaaaagttcgaagacatct
tcatgcgacaaaagtgatacatgtttttaa

DBGET integrated database retrieval system