KEGG   Pan paniscus (bonobo): 100967906Help
Entry
100967906         CDS       T02283                                 

Gene name
COMP
Definition
(RefSeq) cartilage oligomeric matrix protein
  KO
K04659  thrombospondin 2/3/4/5
Organism
pps  Pan paniscus (bonobo)
Pathway
pps04145  Phagosome
pps04151  PI3K-Akt signaling pathway
pps04510  Focal adhesion
pps04512  ECM-receptor interaction
pps05144  Malaria
pps05165  Human papillomavirus infection
Brite
KEGG Orthology (KO) [BR:pps00001]
 Environmental Information Processing
  Signal transduction
   04151 PI3K-Akt signaling pathway
    100967906 (COMP)
  Signaling molecules and interaction
   04512 ECM-receptor interaction
    100967906 (COMP)
 Cellular Processes
  Transport and catabolism
   04145 Phagosome
    100967906 (COMP)
  Cellular community - eukaryotes
   04510 Focal adhesion
    100967906 (COMP)
 Human Diseases
  Infectious diseases
   05165 Human papillomavirus infection
    100967906 (COMP)
   05144 Malaria
    100967906 (COMP)
Membrane trafficking [BR:pps04131]
 Endocytosis
  Phagocytosis
   Opsonins
    100967906 (COMP)
Exosome [BR:pps04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100967906 (COMP)
  Exosomal proteins of colorectal cancer cells
   100967906 (COMP)
  Exosomal proteins of bladder cancer cells
   100967906 (COMP)
Glycosaminoglycan binding proteins [BR:pps00536]
 Heparan sulfate/Haparin
  Extracellular matrix molecules (General comment) Storage depot, cell adhesion and motility, ECM/barrier formation
   100967906 (COMP)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TSP_C TSP_3 COMP EGF_CA cEGF EGF_3 EGF_MSP1_1 hEGF EGF
Motif
Other DBs
NCBI-GeneID: 100967906
NCBI-ProteinID: XP_008969331
Position
19
AA seq 737 aa AA seqDB search
MVPDTACVLLLTLAALGASGQGQSPLGSDLGPQMLRELQETNAALQDVRELLRQQVREIT
FLKNTVMECDACGMQQSVRTGLPSVRPLLHCAPGFCFPGVACIQTESGARCGPCPAGFTG
NGSHCTDVNECNAHPCFPRVRCINTSPGFRCEACPPGYSGPTHEGVGLAFAKANKQVCTD
INECETGQHNCVPNSVCINTRGSFQPDGSPSECHEHADCILERDGSRSCVCAVGWAGNGI
LCGRDTDLDGFPDEKLRCPERQCRKDNCVTVPNSGQEDVDRDGIGDECDLCLLDLISPLT
HPVIQDNCPLVRNPDQRNTDEDKWGDACDNCRSQKNDDQKDTDQDGRGDACDDDIDGDRI
RNQADNCPRVPNSDQKDSDGDGIGDACDNCPQKSNPDQADVDHDFVGDACDSDQDQDGDG
HQDSRDNCPTVPNSAQEDSDHDGQGDACDDDDDNDGVPDSRDNCRLVPNPGQEDADRDGV
GDVCQDDFDADKVVDKIDVCPENAEVTLTDFRAFQTVVLDPEGDAQIDPNWVVLNQGREI
VQTMNSDPGLAVGYTAFNGVDFEGTFHVNTVTDDDYAGFIFGYQDSSSFYVVMWKQMEQT
YWQANPFRAVAEPGIQLKAVKSSTGPGEQLRNALWHTGDTESQVRLLWKDPRNVGWKDKK
SYRWFLQHRPQVGYIRVRFYEGPELVADSNVVLDTTMRGGRLGVFCFSQENIIWANLRYR
CNDTIPEDYETHQLRRA
NT seq 2214 nt NT seq  +upstreamnt  +downstreamnt
atggtccccgacaccgcctgcgttcttctgctcaccctggctgccctcggcgcgtccgga
cagggccagagcccgttgggctcagacctgggcccgcagatgcttcgggaactgcaggaa
accaacgcggcgctgcaggacgtgcgggagctgctgcggcagcaggtcagggagatcacg
ttcctgaaaaacacggtgatggagtgtgacgcgtgcgggatgcagcagtcagtacgcacc
ggcctacccagcgtgcggcccctgctccactgcgcgcccggtttctgcttccctggcgtg
gcctgcatccagacggagagcggcgcgcgctgcggcccctgccccgcgggcttcacgggc
aatggctcgcactgcaccgacgtcaacgagtgcaacgcccacccctgcttcccccgagtc
cgctgtatcaacaccagcccggggttccgctgcgaggcttgcccgccggggtacagcggc
cccacccacgagggcgtggggctggctttcgccaaggccaacaagcaggtttgcacggac
atcaacgagtgtgagaccgggcaacataactgcgtccccaactccgtgtgcatcaacacc
cggggctccttccagcccgacggctcgcccagcgagtgccacgagcatgcagactgcatc
ctagagcgcgatggctcgcggtcgtgcgtgtgtgccgttggctgggccggcaacgggatc
ctctgtggtcgcgacactgacctagacggcttcccggacgagaagctgcgctgcccggag
cgccagtgccgtaaggacaactgcgtgactgtgcccaactcagggcaggaggatgtggac
cgcgatggcatcggagacgagtgtgacctttgccttctcgacctgatctcacccttaacc
caccctgtcatccaggacaactgcccgctggtgcggaacccagaccagcgcaacacggac
gaggacaagtggggcgatgcgtgcgacaactgccggtcccagaagaacgacgaccaaaag
gacacagaccaggacggccggggcgatgcgtgcgacgacgacatcgacggcgaccggatc
cgcaaccaggccgacaactgccctagggtacccaactcagaccagaaggacagtgatggc
gatggtataggggatgcctgtgacaactgtccccagaagagcaacccggatcaggcggat
gtggaccacgactttgtgggagatgcttgtgacagcgatcaagaccaggatggagacgga
catcaggactctcgggacaactgtcccacggtgcctaacagtgcccaggaggactcagac
cacgatggccagggtgatgcctgcgacgacgacgacgacaatgacggagtccctgacagt
cgggacaactgccgcctggtgcctaaccccggccaggaggacgcggacagggacggcgtg
ggcgacgtgtgccaggacgactttgatgcagacaaggtggtagacaagatcgacgtgtgt
ccggagaacgctgaagtcacgctcaccgacttccgggccttccagacagtcgtgctggac
ccggagggtgacgcgcagattgacccaaactgggtggtgctcaaccagggaagggagatc
gtgcagacaatgaacagcgacccaggcctggctgtgggttacactgccttcaatggcgtg
gacttcgagggcacgttccatgtgaacacggtcacggatgacgactatgcgggcttcatc
tttggctaccaggacagctccagcttctacgtggtcatgtggaagcagatggagcaaacg
tattggcaggcgaaccccttccgtgctgtggccgagcctggcatccaactcaaggctgtg
aagtcttccacaggccccggggaacagctgcggaacgctctgtggcatacaggagacaca
gagtcccaggtgcggctgctgtggaaggacccgcgaaacgtgggttggaaggacaagaag
tcctatcgttggttcctgcagcaccggccccaagtgggctacatcagggtgcgattctat
gagggccctgagctggtggctgacagcaacgtggtcttggacacaaccatgcggggtggc
cgcctgggggtcttctgcttctcccaggagaacatcatctgggccaacctgcgttaccgc
tgcaatgacaccatcccagaggactatgagacccatcagctgcggcgagcctag

DBGET integrated database retrieval system