KEGG   Pan paniscus (bonobo): 100967932
Entry
100967932         CDS       T02283                                 

Gene name
TSHB
Definition
(RefSeq) thyroid stimulating hormone beta
  KO
K05251  thyrotropin subunit beta
Organism
pps  Pan paniscus (bonobo)
Pathway
pps04024  cAMP signaling pathway
pps04080  Neuroactive ligand-receptor interaction
pps04918  Thyroid hormone synthesis
pps04923  Regulation of lipolysis in adipocytes
pps05320  Autoimmune thyroid disease
Brite
KEGG Orthology (KO) [BR:pps00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    100967932 (TSHB)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    100967932 (TSHB)
 09150 Organismal Systems
  09152 Endocrine system
   04923 Regulation of lipolysis in adipocytes
    100967932 (TSHB)
   04918 Thyroid hormone synthesis
    100967932 (TSHB)
 09160 Human Diseases
  09163 Immune disease
   05320 Autoimmune thyroid disease
    100967932 (TSHB)
SSDB
Motif
Pfam: Cys_knot
Other DBs
NCBI-GeneID: 100967932
NCBI-ProteinID: XP_003805682
UniProt: A0A2R9AHW6
Position
1
AA seq 138 aa
MTAVFLMSMLFGLACGQAMSFCIPTEYTMHIERRECAYCLTINTTICAGYCMTRDINGKL
FLPKYALSQDVCTYREFIYRTVEIPGCPLHVAPYFSYPVALSCKCGKCNTDYSDCIHEAI
KTNYCTKPQKSYLVGFSV
NT seq 417 nt   +upstreamnt  +downstreamnt
atgactgctgtctttctgatgtccatgctttttggccttgcatgtgggcaagcgatgtct
ttttgtattccaactgagtatacaatgcacatcgaaaggagagagtgtgcttattgccta
accatcaacaccaccatctgtgctggatattgtatgacacgggatatcaatggcaaactg
tttcttcccaaatatgctctgtcccaggatgtttgcacatatagagagttcatctacagg
actgtagaaataccaggatgcccactccatgttgctccctatttttcctatcctgttgct
ttaagctgtaagtgtggcaagtgcaatactgactatagtgactgcatacatgaagccatc
aagacaaactactgtaccaaacctcagaagtcttatctggtaggattttctgtctaa

KEGG   Pan paniscus (bonobo): 100987945
Entry
100987945         CDS       T02283                                 

Gene name
CGA
Definition
(RefSeq) glycoprotein hormones, alpha polypeptide
  KO
K08522  glycoprotein hormones alpha chain
Organism
pps  Pan paniscus (bonobo)
Pathway
pps04024  cAMP signaling pathway
pps04080  Neuroactive ligand-receptor interaction
pps04912  GnRH signaling pathway
pps04913  Ovarian steroidogenesis
pps04917  Prolactin signaling pathway
pps04918  Thyroid hormone synthesis
pps04923  Regulation of lipolysis in adipocytes
pps04929  GnRH secretion
pps05320  Autoimmune thyroid disease
Brite
KEGG Orthology (KO) [BR:pps00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    100987945 (CGA)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    100987945 (CGA)
 09150 Organismal Systems
  09152 Endocrine system
   04923 Regulation of lipolysis in adipocytes
    100987945 (CGA)
   04929 GnRH secretion
    100987945 (CGA)
   04912 GnRH signaling pathway
    100987945 (CGA)
   04913 Ovarian steroidogenesis
    100987945 (CGA)
   04917 Prolactin signaling pathway
    100987945 (CGA)
   04918 Thyroid hormone synthesis
    100987945 (CGA)
 09160 Human Diseases
  09163 Immune disease
   05320 Autoimmune thyroid disease
    100987945 (CGA)
SSDB
Motif
Pfam: Hormone_6
Other DBs
NCBI-GeneID: 100987945
NCBI-ProteinID: XP_003822896
UniProt: A0A2R9A0T2
Position
6
AA seq 116 aa
MDCYRKYAVIFLVTLSVFLHVLHSSPDVQDCPECTLQENPFFSQPGAPILQCMGCCFSRA
YPTPLRSKKTMLVVKNVTSESTCCVAKSYNRVTVMGGFKVENHTACHCSTCYYHKS
NT seq 351 nt   +upstreamnt  +downstreamnt
atggattgctacagaaaatatgcagttatctttctggtcacattgtcggtgtttctgcat
gttctccattcctctcctgatgtgcaggattgcccagaatgcacgctacaggaaaaccca
ttcttctcccagccgggtgccccaatacttcagtgcatgggctgctgcttctctagagca
tatcccactccactaaggtccaagaagacgatgttggtcgtaaagaacgtcacctcagag
tccacttgctgtgtagctaaatcatataacagggtcacagtaatggggggtttcaaagtg
gagaaccacacggcgtgccactgcagtacttgttattatcacaaatcttaa

DBGET integrated database retrieval system