KEGG   Pan paniscus (bonobo): 100968161
Entry
100968161         CDS       T02283                                 

Gene name
CXCR4
Definition
(RefSeq) C-X-C motif chemokine receptor 4
  KO
K04189  C-X-C chemokine receptor type 4
Organism
pps  Pan paniscus (bonobo)
Pathway
pps04020  Calcium signaling pathway
pps04060  Cytokine-cytokine receptor interaction
pps04061  Viral protein interaction with cytokine and cytokine receptor
pps04062  Chemokine signaling pathway
pps04144  Endocytosis
pps04360  Axon guidance
pps04670  Leukocyte transendothelial migration
pps04672  Intestinal immune network for IgA production
pps04810  Regulation of actin cytoskeleton
pps05163  Human cytomegalovirus infection
pps05170  Human immunodeficiency virus 1 infection
pps05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:pps00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    100968161 (CXCR4)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100968161 (CXCR4)
   04061 Viral protein interaction with cytokine and cytokine receptor
    100968161 (CXCR4)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100968161 (CXCR4)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100968161 (CXCR4)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    100968161 (CXCR4)
   04672 Intestinal immune network for IgA production
    100968161 (CXCR4)
   04062 Chemokine signaling pathway
    100968161 (CXCR4)
  09158 Development and regeneration
   04360 Axon guidance
    100968161 (CXCR4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100968161 (CXCR4)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100968161 (CXCR4)
   05163 Human cytomegalovirus infection
    100968161 (CXCR4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:pps04030]
    100968161 (CXCR4)
   04050 Cytokine receptors [BR:pps04050]
    100968161 (CXCR4)
   04090 CD molecules [BR:pps04090]
    100968161 (CXCR4)
G protein-coupled receptors [BR:pps04030]
 Rhodopsin family
  Chemokine
   CXC Chemokine
    100968161 (CXCR4)
Cytokine receptors [BR:pps04050]
 Chemokine receptors
  CXC Chemokine
   100968161 (CXCR4)
CD molecules [BR:pps04090]
 Proteins
  100968161 (CXCR4)
SSDB
Motif
Pfam: 7tm_1 CXCR4_N 7TM_GPCR_Srsx Cybc1_Eros
Other DBs
NCBI-GeneID: 100968161
NCBI-ProteinID: XP_003822867
UniProt: A0A2R9CH84
Position
2B
AA seq 352 aa
MEGISIYTSDNYTEEMGSGDYDSMKEPCFREENANFNKIFLPTIYSIIFLTGIVGNGLVI
LVMGYQKKLRSMTDKYRLHLSVADLLFVITLPFWAVDAVANWYFGNFLCKAVHVIYTVNL
YSSVLILAFISLDRYLAIVHATNSQRPRKLLAEKVVYVGVWIPALLLTIPDFIFANVSEA
DDRYICDRFYPNDLWVVVFQFQHIMVGLILPGIVILSCYCIIISKLSHSKGHQKRKALKT
TVILILAFFACWLPYYIGISIDSFILLEIIKQGCEFENTVHKWISITEALAFFHCCLNPI
LYAFLGAKFKTSAQHALTSVSRGSSLKILSKGKRGGHSSVSTESESSSFHSS
NT seq 1059 nt   +upstreamnt  +downstreamnt
atggaggggatcagtatatacacttcagataactacaccgaggaaatgggctcaggggac
tatgactccatgaaggaaccctgtttccgtgaagaaaatgctaatttcaataaaatcttc
ctgcccaccatctactccatcatcttcttgactggcattgtgggcaatggattggtcatc
ctggtcatgggttaccagaagaaactgagaagcatgacggacaagtacagactgcacctg
tcagtggccgacctcctctttgtcatcacgcttcccttctgggcagttgatgccgtggca
aactggtactttgggaacttcctatgcaaggcagtccatgtcatctacacagtcaacctc
tacagcagtgtcctcatcctggccttcatcagtctggaccgctacctggccattgtccac
gccaccaacagtcagaggccaaggaagctgttggctgaaaaggtggtctatgttggcgtc
tggatccctgccctcctgcttactattcccgacttcatctttgccaacgtcagtgaggca
gatgacagatatatctgtgaccgcttctaccccaatgacttgtgggtggttgtgttccag
tttcagcacatcatggttggccttatcctgcctggtattgtcatcctgtcctgctattgc
attatcatctccaagctgtcacactccaagggccaccagaagcgcaaggccctcaagacc
acagtcatcctcatcctggctttcttcgcctgttggctgccttactacattgggatcagc
atcgactccttcatcctcctggaaatcatcaagcaagggtgtgagtttgagaacactgtg
cacaagtggatttccatcaccgaggccctagctttcttccactgttgtctgaaccccatc
ctctatgctttccttggagccaaatttaaaacctctgcccagcacgcactcacctctgtg
agcagagggtccagcctcaagatcctctccaaaggaaagcgaggtggacattcatctgtt
tccactgagtctgagtcttcaagttttcactccagctaa

DBGET integrated database retrieval system