KEGG   Pan paniscus (bonobo): 100968227
Entry
100968227         CDS       T02283                                 

Gene name
CCR10
Definition
(RefSeq) C-C motif chemokine receptor 10
  KO
K04185  C-C chemokine receptor type 10
Organism
pps  Pan paniscus (bonobo)
Pathway
pps04060  Cytokine-cytokine receptor interaction
pps04061  Viral protein interaction with cytokine and cytokine receptor
pps04062  Chemokine signaling pathway
pps04672  Intestinal immune network for IgA production
Brite
KEGG Orthology (KO) [BR:pps00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100968227 (CCR10)
   04061 Viral protein interaction with cytokine and cytokine receptor
    100968227 (CCR10)
 09150 Organismal Systems
  09151 Immune system
   04672 Intestinal immune network for IgA production
    100968227 (CCR10)
   04062 Chemokine signaling pathway
    100968227 (CCR10)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:pps04030]
    100968227 (CCR10)
   04050 Cytokine receptors [BR:pps04050]
    100968227 (CCR10)
G protein-coupled receptors [BR:pps04030]
 Rhodopsin family
  Chemokine
   CC Chemokine
    100968227 (CCR10)
Cytokine receptors [BR:pps04050]
 Chemokine receptors
  CC Chemokine
   100968227 (CCR10)
SSDB
Motif
Pfam: 7tm_1 DUF1772 Trp_oprn_chp
Other DBs
NCBI-GeneID: 100968227
NCBI-ProteinID: XP_014197521
Position
17
AA seq 140 aa
MVACYALLGRTLLAARGPERRRALRVVVALVAAFVVLQLPYSLALLLDTADLLAARERSC
PASKRKDVALLVTSGLALARCGLNPVLYAFLGLRFRQDLRRLLRGGSCPSGPQPRRGCPR
RPRLSSCSAPTETHSLSWDN
NT seq 423 nt   +upstreamnt  +downstreamnt
atggtagcctgttacgcgcttctgggccgcacgctgctggccgccagggggcccgagcgc
cggcgtgcgctgcgcgtcgtggtggctctggtggcggccttcgtggtgctgcagctgccc
tacagcctcgccctgctgctggatacggccgatctactggctgcgcgcgagcggagctgc
cctgccagcaaacgcaaggatgtcgcactgctggtgaccagcggcttggccctcgcccgc
tgtggcctcaatcccgtgctctacgccttcctgggcctgcgcttccgccaggacctgcgg
aggctgctacggggtgggagctgcccctcagggcctcaaccccgccgcggctgcccccgc
cggccccgcctttcttcctgctcagctcccacggagacccacagtctctcctgggacaac
tag

DBGET integrated database retrieval system