KEGG   Pan paniscus (bonobo): 100968239Help
Entry
100968239         CDS       T02283                                 

Gene name
MGLL
Definition
(RefSeq) monoglyceride lipase
  KO
K01054  acylglycerol lipase [EC:3.1.1.23]
Organism
pps  Pan paniscus (bonobo)
Pathway
pps00561  Glycerolipid metabolism
pps01100  Metabolic pathways
pps04714  Thermogenesis
pps04723  Retrograde endocannabinoid signaling
pps04923  Regulation of lipolysis in adipocytes
Module
pps_M00098  Acylglycerol degradation
Brite
KEGG Orthology (KO) [BR:pps00001]
 09100 Metabolism
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    100968239 (MGLL)
 09150 Organismal Systems
  09152 Endocrine system
   04923 Regulation of lipolysis in adipocyte
    100968239 (MGLL)
  09156 Nervous system
   04723 Retrograde endocannabinoid signaling
    100968239 (MGLL)
  09159 Environmental adaptation
   04714 Thermogenesis
    100968239 (MGLL)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:pps01002]
    100968239 (MGLL)
Enzymes [BR:pps01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     100968239 (MGLL)
Peptidases [BR:pps01002]
 Serine Peptidases
  Family S33
   100968239 (MGLL)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hydrolase_4 Abhydrolase_6 Abhydrolase_1 Esterase Lipase_3 Abhydrolase_3 DLH PGAP1 Abhydrolase_5 Thioesterase LIDHydrolase BAAT_C Abhydrolase_2 DUF1057 DUF1350 DUF2974
Motif
Other DBs
NCBI-GeneID: 100968239
NCBI-ProteinID: XP_003815295
Position
3
AA seq 303 aa AA seqDB search
MPEESSPRRTPQSIPYQDLPHLVNADGQYLFCRYWKPTGTPKALIFVSHGAGEHSGRYEE
LARMLMGLDLLVFAHDHVGHGQSEGERMVVSDFHVFVRDVLQHVDSMQKDYPGLPVFLLG
HSMGGAIAILTAAERPGHFAGMVLISPLVLANPESATTFKVLAAKVLNLVLPNLSLGPID
SSVLSRNKTEVDIYNSDPLICRAGLKVCFGIQLLNAVSRVERALPKLTVPFLLLQGSADR
LCDSKGAYLLMELAKSQDKTLKIYEGAYHVLHKELPEVTNSVFHEINMWVSQRTATAGTA
SPP
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atgccagaggaaagttcccccaggcggaccccgcagagcattccctaccaggacctccct
cacctggtcaatgcagacggacagtacctcttctgcaggtactggaaacccacaggcacg
cccaaggccctcatctttgtgtcccatggagccggagagcacagtggccgctatgaagag
ctggctcggatgctgatggggctggacctgctggtgttcgcccacgaccatgttggccac
ggacagagcgaaggggagaggatggtagtgtctgacttccacgttttcgtcagggatgtg
ttgcagcatgtggattccatgcagaaagactaccctgggcttcctgtcttccttctgggc
cactccatgggaggcgccatcgccatcctcacggccgcagagaggccgggccacttcgcc
ggcatggtactcatttcgcctctggttcttgccaatcctgaatctgcaacaactttcaag
gtccttgctgcgaaagtgctcaaccttgtgctgccaaacttgtccctcgggcccatcgac
tccagcgtgctctctcggaataagacagaggtcgacatttataactcagaccccctgatc
tgccgggcagggctgaaggtgtgcttcggcatccaactgctgaatgccgtctcacgggtg
gagcgcgccctccccaagctgactgtgcccttcctgctgctccagggctctgccgatcgc
ctgtgtgacagcaaaggggcctacctgctcatggagttagccaagagccaggacaagact
ctcaagatttatgaaggtgcctaccatgttctccacaaggagcttcctgaagtcaccaac
tccgtcttccatgaaataaacatgtgggtctctcaaaggacagccacggcaggaactgcg
tccccaccctga

DBGET integrated database retrieval system