KEGG   Pan paniscus (bonobo): 100968258
Entry
100968258         CDS       T02283                                 

Gene name
CCL5
Definition
(RefSeq) C-C motif chemokine ligand 5
  KO
K12499  C-C motif chemokine 5
Organism
pps  Pan paniscus (bonobo)
Pathway
pps04060  Cytokine-cytokine receptor interaction
pps04061  Viral protein interaction with cytokine and cytokine receptor
pps04062  Chemokine signaling pathway
pps04620  Toll-like receptor signaling pathway
pps04621  NOD-like receptor signaling pathway
pps04623  Cytosolic DNA-sensing pathway
pps04668  TNF signaling pathway
pps05020  Prion disease
pps05142  Chagas disease
pps05163  Human cytomegalovirus infection
pps05164  Influenza A
pps05168  Herpes simplex virus 1 infection
pps05323  Rheumatoid arthritis
pps05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:pps00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    100968258 (CCL5)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100968258 (CCL5)
   04061 Viral protein interaction with cytokine and cytokine receptor
    100968258 (CCL5)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    100968258 (CCL5)
   04621 NOD-like receptor signaling pathway
    100968258 (CCL5)
   04623 Cytosolic DNA-sensing pathway
    100968258 (CCL5)
   04062 Chemokine signaling pathway
    100968258 (CCL5)
 09160 Human Diseases
  09172 Infectious disease: viral
   05164 Influenza A
    100968258 (CCL5)
   05168 Herpes simplex virus 1 infection
    100968258 (CCL5)
   05163 Human cytomegalovirus infection
    100968258 (CCL5)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    100968258 (CCL5)
  09163 Immune disease
   05323 Rheumatoid arthritis
    100968258 (CCL5)
  09164 Neurodegenerative disease
   05020 Prion disease
    100968258 (CCL5)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    100968258 (CCL5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:pps04052]
    100968258 (CCL5)
   00536 Glycosaminoglycan binding proteins [BR:pps00536]
    100968258 (CCL5)
Cytokines and growth factors [BR:pps04052]
 Cytokines
  Chemokines
   100968258 (CCL5)
Glycosaminoglycan binding proteins [BR:pps00536]
 Heparan sulfate / Heparin
  Chemokines
   100968258 (CCL5)
SSDB
Motif
Pfam: IL8
Other DBs
NCBI-GeneID: 100968258
NCBI-ProteinID: XP_003818023
UniProt: A0A2R9CSX1
Position
17
AA seq 91 aa
MKVSAAALAVILIATALCAPASASPYSSDTTPCCFAYIARPLPRAHIKEYFYTSGKCSNP
AVVFVTRKNRQVCANPEKKWVREYINSLEMS
NT seq 276 nt   +upstreamnt  +downstreamnt
atgaaggtctccgcggcagccctcgctgtcatcctcattgctactgccctctgcgctcct
gcatctgcctccccatattcctcggacaccacaccctgctgctttgcctacattgcccgc
ccactgccccgtgcccacatcaaggagtatttctacaccagtggcaagtgctccaaccca
gcagtcgtctttgtcacccgaaagaaccgccaagtgtgtgccaacccagagaagaaatgg
gttcgggagtacatcaactctttggagatgagctag

DBGET integrated database retrieval system