KEGG   Pan paniscus (bonobo): 100968286
Entry
100968286         CDS       T02283                                 

Gene name
ZCCHC8
Definition
(RefSeq) zinc finger CCHC-type containing 8
  KO
K13128  zinc finger CCHC domain-containing protein 8
Organism
pps  Pan paniscus (bonobo)
Brite
KEGG Orthology (KO) [BR:pps00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:pps03041]
    100968286 (ZCCHC8)
Spliceosome [BR:pps03041]
 Complex C
  Other components
   Complex C specific factors
    100968286 (ZCCHC8)
SSDB
Motif
Pfam: PSP zf-CCHC Herpes_BLRF2 DivIC
Other DBs
NCBI-GeneID: 100968286
NCBI-ProteinID: XP_003806605
UniProt: A0A2R9CP66
Position
12
AA seq 707 aa
MAAEVYFGDLELFEPFDHPEESIPKPVHTRFKDDDGDEEDENGVGDAELRERLRQCEETI
EQLRAENQELKRKLNILTRPSGILVNDTKLDGPILQILFMNNAISKQYHQEIEEFVSNLV
KRFEEQQKNDVEKTSFNLLPQPSSIVLEEDHKVEESCAIKNNKEAFSVVGSVLYFTNFCL
DKLGQPLLNENPQLSEGWEIPKYHQVFSHIVSLEGQEIQVKAKRPKPHCFNCGSEEHQMK
DCPMPRNAARISEKRKEYMDACGEANNQNFQQRYHAEEVEERFGRFKPGVISEELQDALG
VTDKSLPPFIYRMRQLGYPPGWLKEAELENSGLALYDGKDGTDGETEVGEIQQNKSVTYD
LSKLVNYPGFNISTPRGIPDEWRIFGSIPMQACQQKDVFANYLTSNFQAPGVKSGNKRSS
SHSSPGSPKKQKNESNSAGSPADMELDSDMEVPHGSQSSESFQFQPPLPPDTPPLPRGTP
PPVFTPPLPKGTPPLTPSDSPQTRTASGAVDEDALTLEELEEQQRRIWAALEQAESVNSD
SDVPVDTPLTGNSVASSPCPNELDLPVPEGKTSEKQTLDEPEVPEIFTKKSEAGHASSPD
SEVTSLCQKEKAELALVNTEGALLDNGSVVPNCDISNGGSQKLFPADTSPSMATKIHSPI
PDMSKFATGITPFEFENMAESTGMYLRIRSLLKNSPRNQQKNKKASE
NT seq 2124 nt   +upstreamnt  +downstreamnt
atggccgcagaggtgtattttggcgatctagagctcttcgagccgttcgaccacccagag
gagtcgattccgaagcccgttcacactcgcttcaaggacgacgacggcgacgaggaggac
gaaaatggggtcggcgacgcggagctacgggagcggcttcggcagtgcgaggagaccatc
gagcagctccgcgccgagaatcaagaacttaaacgaaaattgaacattctgactcgaccg
agtggaatattggtgaacgatactaagttagatggacctatattacagattctattcatg
aacaatgctatttcaaagcaatatcatcaagaaatagaggaatttgtatcaaatttagta
aaaagatttgaggaacagcagaaaaatgatgtggaaaagacttcctttaatcttttgccc
cagccatccagtattgtgctagaggaggaccacaaagtggaagagtcctgtgccattaaa
aacaacaaggaagctttcagtgttgtaggaagtgtcctgtattttactaatttttgcctt
gataaattggggcaaccgcttctaaatgaaaaccctcagctttccgaaggatgggaaata
cccaagtaccatcaagtcttcagccacattgtttctctagaagggcaagaaatacaagta
aaggcaaaaaggccaaagcctcactgtttcaattgtggttctgaagaacaccaaatgaaa
gattgcccaatgcctcggaatgctgctcgaataagtgaaaagagaaaagagtatatggat
gcctgtggagaagcaaacaatcagaatttccagcagcgataccacgcagaagaagtagaa
gaaagatttggaagattcaagccaggagttattagtgaggaacttcaagatgcactaggt
gtgacagacaagagtcttccaccttttatctatcggatgcgccagctagggtacccacca
gggtggctcaaagaggctgaattggagaattcggggcttgcactctatgatggaaaagat
ggcactgatggggaaacagaagttggagaaatacaacagaataaaagtgtcacttacgat
ctctcaaaattggtcaactatcctggttttaatatatctactcccagaggaattccagac
gaatggaggatctttggttccataccaatgcaggcatgtcagcagaaggatgtgtttgcc
aattaccttacttctaacttccaagcgccaggtgtgaagtctggcaacaagaggtcttca
tctcactctagcccaggtagtccaaagaagcagaagaatgaaagcaactcagcgggatct
cccgccgacatggagctcgattcagatatggaggtaccacatggttctcagagcagtgaa
agttttcagtttcaaccaccattacctcctgacactcctccactcccccggggaactcct
ccacccgtcttcacccctccactcccaaagggcaccccgccgctgactcccagtgactca
ccccagaccagaacagcatctggagctgtggatgaggacgcactgactctagaagaactt
gaagaacagcagaggcggatctgggcagctcttgagcaggccgagagcgtaaacagtgac
tccgacgttcctgtggacacacctttaactggcaattccgttgcctcatcaccttgtcca
aatgagctagacctccctgtcccggagggaaaaacatctgaaaagcagacgctggatgag
cctgaggtaccagagatttttacaaagaaatcagaagctggacatgcctccagtccagac
tctgaggtgacatcactttgtcagaaggaaaaagcagagttggctctggtaaacactgaa
ggtgcccttcttgataatggaagtgtcgtaccaaactgtgacatcagcaatgggggcagc
cagaagctctttcctgcagacaccagtccttcaatggccactaaaattcatagccctata
cctgacatgagcaaatttgcaactggaatcacgccatttgaatttgagaatatggcagaa
tctactggaatgtacctcaggataagaagcttgttaaagaactcaccccgaaaccagcag
aaaaacaaaaaggcctctgaataa

DBGET integrated database retrieval system