KEGG   Pan paniscus (bonobo): 100968537
Entry
100968537         CDS       T02283                                 

Gene name
TNFRSF13B
Definition
(RefSeq) TNF receptor superfamily member 13B
  KO
K05150  tumor necrosis factor receptor superfamily member 13B
Organism
pps  Pan paniscus (bonobo)
Pathway
pps04060  Cytokine-cytokine receptor interaction
pps04672  Intestinal immune network for IgA production
pps05340  Primary immunodeficiency
Brite
KEGG Orthology (KO) [BR:pps00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100968537 (TNFRSF13B)
 09150 Organismal Systems
  09151 Immune system
   04672 Intestinal immune network for IgA production
    100968537 (TNFRSF13B)
 09160 Human Diseases
  09163 Immune disease
   05340 Primary immunodeficiency
    100968537 (TNFRSF13B)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:pps04050]
    100968537 (TNFRSF13B)
   04090 CD molecules [BR:pps04090]
    100968537 (TNFRSF13B)
Cytokine receptors [BR:pps04050]
 Tumor necrosis factor receptors
  TNF receptor superfamily
   100968537 (TNFRSF13B)
CD molecules [BR:pps04090]
 Proteins
  100968537 (TNFRSF13B)
SSDB
Motif
Pfam: TACI-CRD2 BCMA-Tall_bind BaffR-Tall_bind
Other DBs
NCBI-GeneID: 100968537
NCBI-ProteinID: XP_003808817
UniProt: A0A2R8ZSI5
Position
17
AA seq 293 aa
MSGLGRSRRGGRSRVDQEERFPQGLWTGVAMRSCPEEQYWDPLLGTCMSCKTICNHQSQR
TCAAFCRSLSCRKEQGKFYDHLLRDCISCASICGQHPKQCAYFCENKLRSPVNLPPELRR
QRSGEVENNSDNSGRYQGLEHRGSEPSPALPGLKLSADQVALVYSTLGLCLCAVLCCFLV
AVACFLKKRGDPCSCQPRSRPRQSPAKSSQDHAMEAGSPVSTSPEPVETCSFCFPECRAP
TQESAVTPGTPDPTCAGRWGCHTRTTVLQPCPHIPDSGLGIVCVPAQEGGPGA
NT seq 882 nt   +upstreamnt  +downstreamnt
atgagtggcctgggccggagcaggcgaggtggccggagccgtgtggaccaggaggagcgg
tttccacagggcctgtggacaggggtggctatgagatcctgccccgaagagcagtactgg
gatcctctgctgggtacctgcatgtcctgcaaaaccatttgcaaccatcagagccagcgc
acctgtgcagccttctgcaggtcactcagctgccgcaaggagcaaggcaagttctatgac
catctcctgagggactgcatcagctgtgcctccatctgtggacagcaccctaagcaatgt
gcatacttctgtgagaacaagctcaggagcccagtgaaccttccaccagagctcaggaga
cagcggagtggagaagttgaaaacaattcagacaactcgggaaggtaccaaggattggag
cacagaggctcagaaccaagtccagctctcccgggcctgaagctgagtgcagatcaggtg
gccctcgtctacagcacactggggctctgcctgtgtgccgtcctctgctgcttcctggtg
gcggtggcctgcttcctcaagaagaggggggatccctgctcctgccagccccgctcaagg
ccccgtcaaagtccggccaagtcttcccaggatcacgcgatggaagccggcagccctgtg
agcacatcccccgagccagtggagacctgcagcttctgcttccctgagtgcagggcgccc
acgcaggagagcgcagtcacgcctgggacccccgaccccacttgtgctggaaggtggggg
tgccacaccaggaccacagtcctgcagccttgcccacacatcccagacagcggccttggc
attgtgtgtgtgcctgcccaggaggggggcccaggtgcataa

DBGET integrated database retrieval system