KEGG   Pan paniscus (bonobo): 100968553
Entry
100968553         CDS       T02283                                 

Gene name
RWDD1
Definition
(RefSeq) RWD domain containing 1
Organism
pps  Pan paniscus (bonobo)
SSDB
Motif
Pfam: RWD DFRP_C ACC_central Folliculin PARP BUD22
Other DBs
NCBI-GeneID: 100968553
NCBI-ProteinID: XP_003827621
UniProt: A0A2R9B2G2
Position
6
AA seq 243 aa
MTDYGEEQRNELEALESIYPDSFTVLSENPPSFTITVTSEAGENDETVQTTLKFTYSEKY
PDEAPLYEIFSQENLEDNDVSDILKLLALQAEENLGMVMIFTLVTAVQEKLNEIVDQIKT
RREEEKKQKEKEAEEAEKQLFHGTPVTIENFLNWKAKFDAELLEIKKKRMKEEEQAGKNK
LSGKQLFETDHNLDTSDIQFLEDAGNNVEVDESLFQEMDDLELEDDEDDPDYNPADPESD
SAD
NT seq 732 nt   +upstreamnt  +downstreamnt
atgacagattacggcgaggagcagcgcaacgagctggaggctctggagtccatctaccct
gactccttcacagtattatcagaaaatccacccagcttcaccattactgtgacgtctgag
gctggagaaaatgatgaaactgtccagactaccctcaagtttacatacagtgaaaaatac
ccagatgaagctcccctttatgaaatattctcccaggaaaatctagaagataatgatgtc
tcagacattttaaaattactagcattacaggctgaagaaaatcttggtatggtgatgatt
tttactctagtgacagctgtgcaagaaaaattaaatgaaatagtagatcagataaaaact
agaagagaagaagaaaagaaacaaaaagaaaaagaagcagaagaagctgaaaagcaatta
ttccatggtactccagttacaattgagaatttcttaaattggaaagccaagtttgatgca
gaactcttggaaattaaaaagaaaaggatgaaagaagaagaacaagcaggaaaaaataaa
ttaagtgggaaacaactatttgaaacagatcataatcttgacacatctgatatccagttc
ttggaggatgctggaaacaacgtggaggtagatgagtctttgttccaagaaatggatgac
ttggagctggaggatgatgaagatgatccagactataatcctgctgacccagagagtgac
tcagctgactaa

DBGET integrated database retrieval system