KEGG   Pan paniscus (bonobo): 100968564Help
Entry
100968564         CDS       T02283                                 

Gene name
ATP1A2
Definition
(RefSeq) ATPase Na+/K+ transporting subunit alpha 2
  KO
K01539  sodium/potassium-transporting ATPase subunit alpha [EC:7.2.2.13]
Organism
pps  Pan paniscus (bonobo)
Pathway
pps04022  cGMP-PKG signaling pathway
pps04024  cAMP signaling pathway
pps04260  Cardiac muscle contraction
pps04261  Adrenergic signaling in cardiomyocytes
pps04911  Insulin secretion
pps04918  Thyroid hormone synthesis
pps04919  Thyroid hormone signaling pathway
pps04925  Aldosterone synthesis and secretion
pps04960  Aldosterone-regulated sodium reabsorption
pps04961  Endocrine and other factor-regulated calcium reabsorption
pps04964  Proximal tubule bicarbonate reclamation
pps04970  Salivary secretion
pps04971  Gastric acid secretion
pps04972  Pancreatic secretion
pps04973  Carbohydrate digestion and absorption
pps04974  Protein digestion and absorption
pps04976  Bile secretion
pps04978  Mineral absorption
Brite
KEGG Orthology (KO) [BR:pps00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    100968564 (ATP1A2)
   04022 cGMP-PKG signaling pathway
    100968564 (ATP1A2)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    100968564 (ATP1A2)
   04918 Thyroid hormone synthesis
    100968564 (ATP1A2)
   04919 Thyroid hormone signaling pathway
    100968564 (ATP1A2)
   04925 Aldosterone synthesis and secretion
    100968564 (ATP1A2)
  09153 Circulatory system
   04260 Cardiac muscle contraction
    100968564 (ATP1A2)
   04261 Adrenergic signaling in cardiomyocytes
    100968564 (ATP1A2)
  09154 Digestive system
   04970 Salivary secretion
    100968564 (ATP1A2)
   04971 Gastric acid secretion
    100968564 (ATP1A2)
   04972 Pancreatic secretion
    100968564 (ATP1A2)
   04976 Bile secretion
    100968564 (ATP1A2)
   04973 Carbohydrate digestion and absorption
    100968564 (ATP1A2)
   04974 Protein digestion and absorption
    100968564 (ATP1A2)
   04978 Mineral absorption
    100968564 (ATP1A2)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    100968564 (ATP1A2)
   04961 Endocrine and other factor-regulated calcium reabsorption
    100968564 (ATP1A2)
   04964 Proximal tubule bicarbonate reclamation
    100968564 (ATP1A2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pps04147]
    100968564 (ATP1A2)
Enzymes [BR:pps01000]
 7. Translocases
  7.2  Catalysing the translocation of inorganic cations
   7.2.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.2.2.13  Na+/K+-exchanging ATPase
     100968564 (ATP1A2)
Exosome [BR:pps04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100968564 (ATP1A2)
  Exosomal proteins of other body fluids (saliva and urine)
   100968564 (ATP1A2)
  Exosomal proteins of colorectal cancer cells
   100968564 (ATP1A2)
  Exosomal proteins of bladder cancer cells
   100968564 (ATP1A2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: E1-E2_ATPase Cation_ATPase_C Cation_ATPase Hydrolase Cation_ATPase_N Hydrolase_3 Sigma70_r4
Motif
Other DBs
NCBI-GeneID: 100968564
NCBI-ProteinID: XP_003811938
UniProt: A0A2R9B4R7
Position
1
AA seq 1020 aa AA seqDB search
MGRGAGREYSPAATTAENGGGKKKQKEKELDELKKEVAMDDHKLSLDELGRKYQVDLSKG
LTNQRAQDVLARDGPNALTPPPTTPEWVKFCRQLFGGFSILLWIGAILCFLAYGIQAAME
DEPSNDNLYLGVVLAAVVIVTGCFSYYQEAKSSKIMDSFKNMVPQQALVIREGEKMQINA
EEVVVGDLVEVKGGDRVPADLRIISSHGCKVDNSSLTGESEPQTRSPEFTHENPLETRNI
CFFSTNCVEGTARGIVIATGDRTVMGRIATLASGLEVGRTPIAMEIEHFIQLITGVAVFL
GVSFFVLSLILGYSWLEAVIFLIGIIVANVPEGLLATVTVCLTLTAKRMARKNCLVKNLE
AVETLGSTSTICSDKTGTLTQNRMTVAHMWFDNQIHEADTTEDQSGATFDKRSPTWTALS
RIAGLCNRAVFKAGQENISVSKRDTAGDASESALLKCIELSCGSVRKMRDRNPKVAEIPF
NSTNKYQLSIHEREDSPQSHVLVMKGAPERILDRCSTILVQGKEIPLDKEMQDAFQNAYM
ELGGLGERVLGFCQLNLPSGKFPRGFKFDTDELNFPTEKLCFVGLMSMIDPPRAAVPDAV
GKCRSAGIKVIMVTGDHPITAKAIAKGVGIISEGNETVEDIAARLNIPMSQVNPREAKAC
VVHGSDLKDMTSEQLDEILKNHTEIVFARTSPQQKLIIVEGCQRQGAIVAVTGDGVNDSP
ALKKADIGIAMGISGSDVSKQAADMILLDDNFASIVTGVEEGRLIFDNLKKSIAYTLTSN
IPEITPFLLFIIANIPLPLGTVTILCIDLGTDMVPAISLAYEAAESDIMKRQPRNSQTDK
LVNERLISMAYGQIGMIQALGGFFTYFVILAENGFLPSRLLGIRLDWDDRTMNDLEDSYG
QEWTYEQRKVVEFTCHTAFFASIVVVQWADLIICKTRRNSVFQQGMKNKILIFGLLEETA
LAAFLSYCPGMGVALRMYPLKVTWWFCAFPYSLLIFIYDEVRKLILRRYPGGWVEKETYY
NT seq 3063 nt NT seq  +upstreamnt  +downstreamnt
atgggccgtggggctggccgtgagtactcacctgccgccaccacggcagagaatgggggc
ggcaagaagaaacagaaggagaaggaactggatgagctgaagaaggaggtggcaatggat
gaccacaagctgtccttggatgagctgggccgcaaataccaagtggacctgtccaagggc
ctcaccaaccagcgggctcaggacgttctggctcgagatgggcccaatgccctcacacca
cctcccacaacccctgagtgggtcaagttctgccgtcagcttttcggggggttctccatc
ctgctgtggattggggctatcctctgcttcctggcctacggcatccaggctgccatggag
gatgaaccatccaacgacaatctatatctgggcgtggtgctggcagctgtggtcattgtc
actggctgcttctcctactaccaggaggccaagagctccaagatcatggattccttcaag
aacatggtacctcagcaagcccttgtgatccgggagggagagaagatgcagatcaatgca
gaggaagtggtggtgggagacctggtggaggtgaagggtggagaccgagtccctgctgac
ctccggatcatctcttctcatggctgtaaggtggataactcatccttaacaggagagtcg
gagccccagacccgctcccccgagttcacccatgagaaccccctggagacccgcaatatc
tgtttcttctccaccaactgtgttgaaggcactgccaggggcattgtgattgccacagga
gaccggacggtgatgggccgcatagctactctcgcctcaggcctggaggttgggcggaca
cccatagcaatggagattgaacacttcatccagctgatcacaggggtcgctgtattcctg
ggggtctccttcttcgtgctctccctcatcctgggctacagctggctggaggcagtcatc
ttcctcatcggcatcatagtggccaacgtgcctgaggggcttctggccactgtcactgtg
tgcctgaccctgacagccaagcgcatggcacggaagaactgcctggtgaagaacctggag
gcggtggagacgctgggctccacgtccaccatctgctcggacaagacgggcaccctcacc
cagaaccgcatgaccgtcgcccacatgtggttcgacaaccaaatccatgaggctgacacc
accgaagatcagtctggggccacttttgacaaacgatcccctacgtggacggccctgtct
cgaattgctggtctctgcaaccgcgccgtcttcaaggcaggacaggagaacatctccgtg
tctaagcgggacacagctggtgatgcctccgagtcagctctgctcaagtgcatcgagctc
tcctgtggctcagtgaggaagatgagagacagaaaccccaaggtggcagagattcctttc
aactcgaccaacaagtaccagctgtctatccacgagcgagaagacagcccccagagccac
gtgctggtgatgaagggggccccagagcgcattctggaccggtgctccaccatcctggtg
cagggcaaggagatcccgctcgacaaggagatgcaagatgcctttcaaaatgcctacatg
gagctggggggacttggggagcgtgtgctgggattctgtcaactgaatctgccatctgga
aagtttcctcggggcttcaaattcgacacggatgagctgaactttcccacggagaagctt
tgctttgtggggctcatgtctatgattgaccctccccgggctgctgtgccagatgctgtg
ggcaagtgccgaagcgcaggcatcaaggtgatcatggtaaccggggatcaccctatcaca
gccaaggccattgccaaaggcgtgggcatcatatcagagggtaacgagactgtggaggac
attgcagcccggctcaacattcccatgagtcaagtcaaccccagagaagccaaggcatgc
gtggtgcacggctctgacctgaaggatatgacatcggagcagctcgatgagatcctcaag
aaccacacagagatcgtctttgctcgaacgtctccccagcagaagctcatcattgtggag
ggatgtcagaggcagggagccattgtggccgtgacgggtgacggggtgaatgactcccct
gcattgaagaaggctgacattggcattgccatgggcatctctggctctgacgtctctaag
caggcagccgacatgatcctgctggatgacaactttgcctccatcgtcacgggggtggag
gagggccgcctgatctttgacaacttgaagaaatccatcgcctacaccctgaccagcaac
atccccgagatcacccccttcctgctgttcatcattgccaacatccccctacctctgggc
actgtgaccatcctttgcattgacctgggcacagatatggtccctgccatctccttggcc
tatgaggcagctgagagtgatatcatgaagcggcagccacgaaactcccagacagacaag
ctggtgaatgagaggctcatcagcatggcctatggacagatcgggatgatccaggcactg
ggtggcttcttcacctactttgtgatcctggcagagaacggtttcctgccatcacggcta
ctgggaatccgcctcgactgggatgaccggaccatgaatgatctggaggacagctatgga
caggagtggacctatgagcagcggaaggtggtggagttcacgtgccacacggcattcttt
gccagcatcgtggtggtgcagtgggctgacctcatcatctgcaagacccgccgcaactca
gtcttccagcagggcatgaagaacaagatcctgatttttgggctcctggaggagacggcg
ttggctgcctttctctcttactgcccaggcatgggtgtagccctccgcatgtacccgctc
aaagtcacctggtggttctgcgccttcccctacagcctcctcatcttcatctatgatgag
gtccgaaagctcatcctgcggcggtatcctggtggctgggtggagaaggagacatactac
tga

DBGET integrated database retrieval system