KEGG   Pan paniscus (bonobo): 100968593
Entry
100968593         CDS       T02283                                 

Gene name
PPP3CB
Definition
(RefSeq) protein phosphatase 3 catalytic subunit beta
  KO
K04348  serine/threonine-protein phosphatase 2B catalytic subunit [EC:3.1.3.16]
Organism
pps  Pan paniscus (bonobo)
Pathway
pps04010  MAPK signaling pathway
pps04020  Calcium signaling pathway
pps04022  cGMP-PKG signaling pathway
pps04114  Oocyte meiosis
pps04218  Cellular senescence
pps04310  Wnt signaling pathway
pps04360  Axon guidance
pps04370  VEGF signaling pathway
pps04380  Osteoclast differentiation
pps04625  C-type lectin receptor signaling pathway
pps04650  Natural killer cell mediated cytotoxicity
pps04658  Th1 and Th2 cell differentiation
pps04659  Th17 cell differentiation
pps04660  T cell receptor signaling pathway
pps04662  B cell receptor signaling pathway
pps04720  Long-term potentiation
pps04724  Glutamatergic synapse
pps04728  Dopaminergic synapse
pps04921  Oxytocin signaling pathway
pps04922  Glucagon signaling pathway
pps04924  Renin secretion
pps05010  Alzheimer disease
pps05014  Amyotrophic lateral sclerosis
pps05020  Prion disease
pps05022  Pathways of neurodegeneration - multiple diseases
pps05031  Amphetamine addiction
pps05152  Tuberculosis
pps05163  Human cytomegalovirus infection
pps05166  Human T-cell leukemia virus 1 infection
pps05167  Kaposi sarcoma-associated herpesvirus infection
pps05170  Human immunodeficiency virus 1 infection
pps05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
pps05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:pps00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100968593 (PPP3CB)
   04310 Wnt signaling pathway
    100968593 (PPP3CB)
   04370 VEGF signaling pathway
    100968593 (PPP3CB)
   04020 Calcium signaling pathway
    100968593 (PPP3CB)
   04022 cGMP-PKG signaling pathway
    100968593 (PPP3CB)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    100968593 (PPP3CB)
   04218 Cellular senescence
    100968593 (PPP3CB)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    100968593 (PPP3CB)
   04650 Natural killer cell mediated cytotoxicity
    100968593 (PPP3CB)
   04660 T cell receptor signaling pathway
    100968593 (PPP3CB)
   04658 Th1 and Th2 cell differentiation
    100968593 (PPP3CB)
   04659 Th17 cell differentiation
    100968593 (PPP3CB)
   04662 B cell receptor signaling pathway
    100968593 (PPP3CB)
  09152 Endocrine system
   04922 Glucagon signaling pathway
    100968593 (PPP3CB)
   04921 Oxytocin signaling pathway
    100968593 (PPP3CB)
   04924 Renin secretion
    100968593 (PPP3CB)
  09156 Nervous system
   04724 Glutamatergic synapse
    100968593 (PPP3CB)
   04728 Dopaminergic synapse
    100968593 (PPP3CB)
   04720 Long-term potentiation
    100968593 (PPP3CB)
  09158 Development and regeneration
   04360 Axon guidance
    100968593 (PPP3CB)
   04380 Osteoclast differentiation
    100968593 (PPP3CB)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100968593 (PPP3CB)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100968593 (PPP3CB)
   05170 Human immunodeficiency virus 1 infection
    100968593 (PPP3CB)
   05163 Human cytomegalovirus infection
    100968593 (PPP3CB)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100968593 (PPP3CB)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    100968593 (PPP3CB)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100968593 (PPP3CB)
   05014 Amyotrophic lateral sclerosis
    100968593 (PPP3CB)
   05020 Prion disease
    100968593 (PPP3CB)
   05022 Pathways of neurodegeneration - multiple diseases
    100968593 (PPP3CB)
  09165 Substance dependence
   05031 Amphetamine addiction
    100968593 (PPP3CB)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    100968593 (PPP3CB)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:pps01009]
    100968593 (PPP3CB)
Enzymes [BR:pps01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     100968593 (PPP3CB)
Protein phosphatases and associated proteins [BR:pps01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Catalytic subunits
     100968593 (PPP3CB)
SSDB
Motif
Pfam: Metallophos
Other DBs
NCBI-GeneID: 100968593
NCBI-ProteinID: XP_008967260
Position
10
AA seq 439 aa
MIEVEAPITVCGDIHGQFFDLMKLFEVGGSPANTRYLFLGDYVDRGYFSIECVLYLWVLK
ILYPSTLFLLRGNHECRHLTEYFTFKQECKIKYSERVYEACMEAFDSLPLAALLNQQFLC
VHGGLSPEIHTLDDIRRLDRFKEPPAFGPMCDLLWSDPSEDFGNEKSQEHFSHNTVRGCS
YFYNYPAVCEFLQNNNLLSIIRAHEAQDAGYRMYRKSQTTGFPSLITIFSAPNYLDVYNN
KAAVLKYENNVMNIRQFNCSPHPYWLPNFMDVFTWSLPFVGEKVTEMLVNVLSICSDDEL
MTEGEDQFDVGSAAARKEIIRNKIRAIGKMARVFSVLREESESVLTLKGLTPTGMLPSGV
LAGGRQTLQSATVEAIEAEKAIRGFSPPHRICSFEEAKGLDRINERMPPRKDAVQQDGFN
SLNTAHATENHGTGNHTAQ
NT seq 1320 nt   +upstreamnt  +downstreamnt
atgatagaagtagaagctccaatcacagtgtgtggtgacatccatggccaattttttgat
ctgatgaaactttttgaagtaggaggatcacctgctaatacacgatacctttttcttggc
gattatgtggacagaggttattttagtatagagtgtgtcttatatttatgggttctgaag
attctatacccaagcacattatttcttctgagaggcaaccatgaatgcagacaccttact
gaatattttacctttaagcaggaatgtaaaattaagtattcggaaagagtctatgaagct
tgcatggaagcttttgatagtttgcctcttgctgcacttttaaaccaacagtttctttgt
gttcatggtggactttcaccagaaatacacacactggatgatattaggagattagataga
ttcaaagagccacctgcatttggaccaatgtgtgacttgttatggtccgatccttctgaa
gattttggaaatgaaaaatcacaggaacattttagtcacaatacagttcgaggatgttct
tatttttataactatccagcagtgtgtgaatttttgcaaaacaataatttgttatcgatt
attagagctcatgaagctcaagatgcaggctatagaatgtacagaaaaagtcaaactaca
gggttcccttcattaataacaattttttcggcacctaattacttagatgtctacaataat
aaagctgctgtattaaagtatgaaaataatgtgatgaatattcgacagtttaactgttct
ccacatccttactggttgcctaattttatggatgtcttcacgtggtctttaccgtttgtt
ggagaaaaagtgacagaaatgttggtaaatgttctgagtatttgctctgatgatgaacta
atgactgaaggtgaagaccagtttgatgtaggttcagctgcagcccggaaagaaatcata
agaaacaaaattcgagcaattggcaagatggcaagagtcttctctgttctcagggaggag
agtgaaagtgtgctgacactcaagggcctgactcccacagggatgttgcctagtggagtg
ttagctggaggacggcagaccctgcaaagtgccacagttgaggctattgaggctgaaaaa
gcaatacgaggattctctccaccacatagaatctgcagttttgaagaggcaaagggtttg
gataggatcaatgagagaatgccacctcggaaagatgctgtacagcaagatggtttcaat
tctctgaacaccgcacatgccactgagaaccacgggacgggcaaccatactgcccagtga

KEGG   Pan paniscus (bonobo): 100976831
Entry
100976831         CDS       T02283                                 

Gene name
PPP3CC
Definition
(RefSeq) protein phosphatase 3 catalytic subunit gamma
  KO
K04348  serine/threonine-protein phosphatase 2B catalytic subunit [EC:3.1.3.16]
Organism
pps  Pan paniscus (bonobo)
Pathway
pps04010  MAPK signaling pathway
pps04020  Calcium signaling pathway
pps04022  cGMP-PKG signaling pathway
pps04114  Oocyte meiosis
pps04218  Cellular senescence
pps04310  Wnt signaling pathway
pps04360  Axon guidance
pps04370  VEGF signaling pathway
pps04380  Osteoclast differentiation
pps04625  C-type lectin receptor signaling pathway
pps04650  Natural killer cell mediated cytotoxicity
pps04658  Th1 and Th2 cell differentiation
pps04659  Th17 cell differentiation
pps04660  T cell receptor signaling pathway
pps04662  B cell receptor signaling pathway
pps04720  Long-term potentiation
pps04724  Glutamatergic synapse
pps04728  Dopaminergic synapse
pps04921  Oxytocin signaling pathway
pps04922  Glucagon signaling pathway
pps04924  Renin secretion
pps05010  Alzheimer disease
pps05014  Amyotrophic lateral sclerosis
pps05020  Prion disease
pps05022  Pathways of neurodegeneration - multiple diseases
pps05031  Amphetamine addiction
pps05152  Tuberculosis
pps05163  Human cytomegalovirus infection
pps05166  Human T-cell leukemia virus 1 infection
pps05167  Kaposi sarcoma-associated herpesvirus infection
pps05170  Human immunodeficiency virus 1 infection
pps05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
pps05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:pps00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100976831 (PPP3CC)
   04310 Wnt signaling pathway
    100976831 (PPP3CC)
   04370 VEGF signaling pathway
    100976831 (PPP3CC)
   04020 Calcium signaling pathway
    100976831 (PPP3CC)
   04022 cGMP-PKG signaling pathway
    100976831 (PPP3CC)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    100976831 (PPP3CC)
   04218 Cellular senescence
    100976831 (PPP3CC)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    100976831 (PPP3CC)
   04650 Natural killer cell mediated cytotoxicity
    100976831 (PPP3CC)
   04660 T cell receptor signaling pathway
    100976831 (PPP3CC)
   04658 Th1 and Th2 cell differentiation
    100976831 (PPP3CC)
   04659 Th17 cell differentiation
    100976831 (PPP3CC)
   04662 B cell receptor signaling pathway
    100976831 (PPP3CC)
  09152 Endocrine system
   04922 Glucagon signaling pathway
    100976831 (PPP3CC)
   04921 Oxytocin signaling pathway
    100976831 (PPP3CC)
   04924 Renin secretion
    100976831 (PPP3CC)
  09156 Nervous system
   04724 Glutamatergic synapse
    100976831 (PPP3CC)
   04728 Dopaminergic synapse
    100976831 (PPP3CC)
   04720 Long-term potentiation
    100976831 (PPP3CC)
  09158 Development and regeneration
   04360 Axon guidance
    100976831 (PPP3CC)
   04380 Osteoclast differentiation
    100976831 (PPP3CC)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100976831 (PPP3CC)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100976831 (PPP3CC)
   05170 Human immunodeficiency virus 1 infection
    100976831 (PPP3CC)
   05163 Human cytomegalovirus infection
    100976831 (PPP3CC)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100976831 (PPP3CC)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    100976831 (PPP3CC)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100976831 (PPP3CC)
   05014 Amyotrophic lateral sclerosis
    100976831 (PPP3CC)
   05020 Prion disease
    100976831 (PPP3CC)
   05022 Pathways of neurodegeneration - multiple diseases
    100976831 (PPP3CC)
  09165 Substance dependence
   05031 Amphetamine addiction
    100976831 (PPP3CC)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    100976831 (PPP3CC)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:pps01009]
    100976831 (PPP3CC)
Enzymes [BR:pps01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     100976831 (PPP3CC)
Protein phosphatases and associated proteins [BR:pps01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Catalytic subunits
     100976831 (PPP3CC)
SSDB
Motif
Pfam: Metallophos
Other DBs
NCBI-GeneID: 100976831
NCBI-ProteinID: XP_008975479
Position
8
AA seq 412 aa
MIEVDAPITVCGDIHGQFFDLMKLFEVGGSPSNTRYLFLGDYVDRGYFSIECVLYLWSLK
INHPKTLFLLRGNHECRHLTDYFTFKQECRIKYSEQVYDACMETFDCLPLAALLNQQFLC
VHGGMSPEITSLDDIRKLDRFTEPPAFGPVCDLLWSDPSEDYGNEKTLEHYTHNTVRGCS
YFYSYPAVCEFLQNNNLLSIIRAHEAQDAGYRMYRKSQATGFPSLITIFSAPNYLDVYNN
KAAVLKYENNVMNIRQFNCSPHPYWLPNFMDVFTWSLPFVGEKVTEMLVNVLNICSDDEL
ISDDEAEGSTTVRKEIIRNKIRAIGKMARVFSILRQESESVLTLKGLTPTGTLPLGVLSG
GKQTIETALMQRQKLKQLVMRGQVVYFCIPSMYKRHPFDSKESQIGQPLQRF
NT seq 1239 nt   +upstreamnt  +downstreamnt
atgatagaagtagatgctccaatcacagtatgtggtgatattcatggacaattctttgac
ctaatgaagttatttgaagttggaggatcacctagtaacacacgctacctctttctgggt
gactatgtggacagaggctatttcagtatagagtgtgtgctgtatttatggagtttaaag
attaatcatcccaaaacattgtttctgcttcggggaaatcatgaatgcagacatcttaca
gactatttcaccttcaaacaggaatgtcgaatcaaatattcggaacaggtgtatgatgcc
tgtatggagacatttgactgtcttcctcttgctgccctcttaaaccagcagtttctctgt
gtacatggaggaatgtcacctgaaattacttctttagatgacattaggaaattagacagg
tttacggaacctcccgcctttggacctgtgtgtgacctgctttggtctgatccctcagag
gattatggcaatgagaagaccttggagcactatacccacaacactgtccgagggtgctct
tatttctacagttaccctgcagtttgtgaatttttgcagaacaataatttactatcaatt
atcagagcccatgaagcccaagatgctgggtatcgaatgtacaggaagagccaagcaaca
ggctttccatcacttattacaattttctctgcccccaattacctagatgtctataacaat
aaagctgctgtgttgaaatatgaaaacaatgtcatgaatatcaggcagtttaactgttct
ccacacccctactggcttccaaactttatggatgttttcacatggtctttgccttttgtt
ggggaaaaagtcacagagatgctggtaaatgtgctcaacatatgctctgatgacgaactg
atttctgatgatgaagcagaaggaagcactacagttcgtaaggagatcatcaggaataag
atcagagccattgggaagatggcacgggtcttttcaattcttcggcaagaaagtgagagt
gtgctgactctcaagggcctgactcccacaggcacactccctctgggcgtcctctcagga
ggcaagcagactatcgagacagctttaatgcaacggcagaagcttaagcaactggtcatg
agaggtcaagtggtttacttctgtatcccttccatgtacaagagacatccatttgattct
aaagagagccaaataggtcagcctcttcagcgattctaa

KEGG   Pan paniscus (bonobo): 100976987
Entry
100976987         CDS       T02283                                 

Gene name
PPP3CA
Definition
(RefSeq) protein phosphatase 3 catalytic subunit alpha
  KO
K04348  serine/threonine-protein phosphatase 2B catalytic subunit [EC:3.1.3.16]
Organism
pps  Pan paniscus (bonobo)
Pathway
pps04010  MAPK signaling pathway
pps04020  Calcium signaling pathway
pps04022  cGMP-PKG signaling pathway
pps04114  Oocyte meiosis
pps04218  Cellular senescence
pps04310  Wnt signaling pathway
pps04360  Axon guidance
pps04370  VEGF signaling pathway
pps04380  Osteoclast differentiation
pps04625  C-type lectin receptor signaling pathway
pps04650  Natural killer cell mediated cytotoxicity
pps04658  Th1 and Th2 cell differentiation
pps04659  Th17 cell differentiation
pps04660  T cell receptor signaling pathway
pps04662  B cell receptor signaling pathway
pps04720  Long-term potentiation
pps04724  Glutamatergic synapse
pps04728  Dopaminergic synapse
pps04921  Oxytocin signaling pathway
pps04922  Glucagon signaling pathway
pps04924  Renin secretion
pps05010  Alzheimer disease
pps05014  Amyotrophic lateral sclerosis
pps05020  Prion disease
pps05022  Pathways of neurodegeneration - multiple diseases
pps05031  Amphetamine addiction
pps05152  Tuberculosis
pps05163  Human cytomegalovirus infection
pps05166  Human T-cell leukemia virus 1 infection
pps05167  Kaposi sarcoma-associated herpesvirus infection
pps05170  Human immunodeficiency virus 1 infection
pps05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
pps05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:pps00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100976987 (PPP3CA)
   04310 Wnt signaling pathway
    100976987 (PPP3CA)
   04370 VEGF signaling pathway
    100976987 (PPP3CA)
   04020 Calcium signaling pathway
    100976987 (PPP3CA)
   04022 cGMP-PKG signaling pathway
    100976987 (PPP3CA)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    100976987 (PPP3CA)
   04218 Cellular senescence
    100976987 (PPP3CA)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    100976987 (PPP3CA)
   04650 Natural killer cell mediated cytotoxicity
    100976987 (PPP3CA)
   04660 T cell receptor signaling pathway
    100976987 (PPP3CA)
   04658 Th1 and Th2 cell differentiation
    100976987 (PPP3CA)
   04659 Th17 cell differentiation
    100976987 (PPP3CA)
   04662 B cell receptor signaling pathway
    100976987 (PPP3CA)
  09152 Endocrine system
   04922 Glucagon signaling pathway
    100976987 (PPP3CA)
   04921 Oxytocin signaling pathway
    100976987 (PPP3CA)
   04924 Renin secretion
    100976987 (PPP3CA)
  09156 Nervous system
   04724 Glutamatergic synapse
    100976987 (PPP3CA)
   04728 Dopaminergic synapse
    100976987 (PPP3CA)
   04720 Long-term potentiation
    100976987 (PPP3CA)
  09158 Development and regeneration
   04360 Axon guidance
    100976987 (PPP3CA)
   04380 Osteoclast differentiation
    100976987 (PPP3CA)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100976987 (PPP3CA)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100976987 (PPP3CA)
   05170 Human immunodeficiency virus 1 infection
    100976987 (PPP3CA)
   05163 Human cytomegalovirus infection
    100976987 (PPP3CA)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100976987 (PPP3CA)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    100976987 (PPP3CA)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100976987 (PPP3CA)
   05014 Amyotrophic lateral sclerosis
    100976987 (PPP3CA)
   05020 Prion disease
    100976987 (PPP3CA)
   05022 Pathways of neurodegeneration - multiple diseases
    100976987 (PPP3CA)
  09165 Substance dependence
   05031 Amphetamine addiction
    100976987 (PPP3CA)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    100976987 (PPP3CA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:pps01009]
    100976987 (PPP3CA)
Enzymes [BR:pps01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     100976987 (PPP3CA)
Protein phosphatases and associated proteins [BR:pps01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Catalytic subunits
     100976987 (PPP3CA)
SSDB
Motif
Pfam: Metallophos
Other DBs
NCBI-GeneID: 100976987
NCBI-ProteinID: XP_003829994
UniProt: A0A2R9CDE3
Position
4
AA seq 521 aa
MSEPKAIDPKLSTTDRVVKAVPFPPSHRLTAKEVFDNDGKPRVDILKAHLMKEGRLEESV
ALRIITEGASILRQEKNLLDIDAPVTVCGDIHGQFFDLMKLFEVGGSPANTRYLFLGDYV
DRGYFSIECVLYLWALKILYPKTLFLLRGNHECRHLTEYFTFKQECKIKYSERVYDACMD
AFDCLPLAALMNQQFLCVHGGLSPEINTLDDIRKLDRFKEPPAYGPMCDILWSDPLEDFG
NEKTQEHFTHNTVRGCSYFYSYPAVCEFLQHNNLLSILRAHEAQDAGYRMYRKSQTTGFP
SLITIFSAPNYLDVYNNKAAVLKYENNVMNIRQFNCSPHPYWLPNFMDVFTWSLPFVGEK
VTEMLVNVLNICSDDELGSEEDGFDGATAAARKEVIRNKIRAIGKMARVFSVLREESESV
LTLKGLTPTGMLPSGVLSGGKQTLQSATVEAIEADEAIKGFSPQHKITSFEEAKGLDRIN
ERMPPRRDAMPSDANLNSINKALTSETNGTDSNGSNSSNIQ
NT seq 1566 nt   +upstreamnt  +downstreamnt
atgtccgagcccaaggcaattgatcccaagttgtcgacgaccgacagggtggtgaaagct
gttccatttcctccaagtcaccggcttacagcaaaagaagtgtttgataatgatggaaaa
cctcgtgtggatatcttaaaggcgcatcttatgaaggagggaaggctggaagagagtgtt
gcattgagaataataacagagggtgcatcaattcttcgacaggaaaaaaatttgctggat
attgatgcgccagtcactgtttgtggggacattcatggacaattctttgatttgatgaag
ctctttgaagtcgggggatctcctgccaacactcgctacctcttcttaggggactatgtt
gacagagggtacttcagtattgaatgtgtgctgtatttgtgggccttgaaaattctctac
cccaaaacactgtttttacttcgtggaaatcatgaatgtagacatctaacagagtatttc
acatttaaacaagaatgtaaaataaagtattcagaacgcgtatatgatgcctgtatggat
gcctttgactgccttcccctggctgccctgatgaaccaacagttcctgtgtgtacatggt
ggtttgtctccagagattaacactttagatgatatcagaaaattagaccgattcaaagaa
ccacctgcatatggacctatgtgtgatatcctgtggtcagaccccctggaagattttgga
aatgagaagactcaggaacatttcactcacaacacagtcagggggtgttcatacttctac
agttacccggctgtatgtgaattcttacagcacaataacttgttatctatactccgagcc
cacgaagcccaagatgcagggtaccgcatgtacaggaaaagccaaacaacaggcttccct
tctctaattacaattttttcagcaccaaattacttagatgtatacaataacaaagctgca
gtattgaagtatgagaacaatgttatgaatatcaggcaattcaactgttctcctcatcca
tactggcttccaaatttcatggatgtttttacttggtcccttccatttgttggggaaaaa
gtgactgagatgctggtaaatgtcctcaacatctgctcagacgatgaactagggtcagaa
gaagatggatttgatggtgcaacagctgcagcccggaaagaggtgataaggaacaagatc
cgagcaataggcaaaatggccagagtgttctcagtgctcagagaagagagtgagagtgtg
ctgacgctgaaaggcttgaccccaactggcatgctccccagcggagtactttctggaggg
aagcaaaccctgcaaagcgctactgttgaggctattgaggctgatgaagctatcaaagga
ttttcaccacaacataagatcactagcttcgaggaagccaagggcttagaccgaattaat
gagaggatgccacctcgcagagatgccatgccctctgacgccaaccttaactccatcaac
aaggctctcacctcagagactaacggcacggacagcaatggcagtaatagcagcaatatt
cagtga

KEGG   Pan paniscus (bonobo): 100995767
Entry
100995767         CDS       T02283                                 

Gene name
PPP3R2
Definition
(RefSeq) protein phosphatase 3 regulatory subunit B, beta
  KO
K06268  serine/threonine-protein phosphatase 2B regulatory subunit
Organism
pps  Pan paniscus (bonobo)
Pathway
pps04010  MAPK signaling pathway
pps04020  Calcium signaling pathway
pps04022  cGMP-PKG signaling pathway
pps04114  Oocyte meiosis
pps04218  Cellular senescence
pps04310  Wnt signaling pathway
pps04360  Axon guidance
pps04370  VEGF signaling pathway
pps04380  Osteoclast differentiation
pps04625  C-type lectin receptor signaling pathway
pps04650  Natural killer cell mediated cytotoxicity
pps04658  Th1 and Th2 cell differentiation
pps04659  Th17 cell differentiation
pps04660  T cell receptor signaling pathway
pps04662  B cell receptor signaling pathway
pps04720  Long-term potentiation
pps04724  Glutamatergic synapse
pps04921  Oxytocin signaling pathway
pps04922  Glucagon signaling pathway
pps04924  Renin secretion
pps05010  Alzheimer disease
pps05014  Amyotrophic lateral sclerosis
pps05020  Prion disease
pps05022  Pathways of neurodegeneration - multiple diseases
pps05031  Amphetamine addiction
pps05152  Tuberculosis
pps05163  Human cytomegalovirus infection
pps05166  Human T-cell leukemia virus 1 infection
pps05167  Kaposi sarcoma-associated herpesvirus infection
pps05170  Human immunodeficiency virus 1 infection
pps05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
pps05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:pps00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100995767 (PPP3R2)
   04310 Wnt signaling pathway
    100995767 (PPP3R2)
   04370 VEGF signaling pathway
    100995767 (PPP3R2)
   04020 Calcium signaling pathway
    100995767 (PPP3R2)
   04022 cGMP-PKG signaling pathway
    100995767 (PPP3R2)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    100995767 (PPP3R2)
   04218 Cellular senescence
    100995767 (PPP3R2)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    100995767 (PPP3R2)
   04650 Natural killer cell mediated cytotoxicity
    100995767 (PPP3R2)
   04660 T cell receptor signaling pathway
    100995767 (PPP3R2)
   04658 Th1 and Th2 cell differentiation
    100995767 (PPP3R2)
   04659 Th17 cell differentiation
    100995767 (PPP3R2)
   04662 B cell receptor signaling pathway
    100995767 (PPP3R2)
  09152 Endocrine system
   04922 Glucagon signaling pathway
    100995767 (PPP3R2)
   04921 Oxytocin signaling pathway
    100995767 (PPP3R2)
   04924 Renin secretion
    100995767 (PPP3R2)
  09156 Nervous system
   04724 Glutamatergic synapse
    100995767 (PPP3R2)
   04720 Long-term potentiation
    100995767 (PPP3R2)
  09158 Development and regeneration
   04360 Axon guidance
    100995767 (PPP3R2)
   04380 Osteoclast differentiation
    100995767 (PPP3R2)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100995767 (PPP3R2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100995767 (PPP3R2)
   05170 Human immunodeficiency virus 1 infection
    100995767 (PPP3R2)
   05163 Human cytomegalovirus infection
    100995767 (PPP3R2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100995767 (PPP3R2)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    100995767 (PPP3R2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100995767 (PPP3R2)
   05014 Amyotrophic lateral sclerosis
    100995767 (PPP3R2)
   05020 Prion disease
    100995767 (PPP3R2)
   05022 Pathways of neurodegeneration - multiple diseases
    100995767 (PPP3R2)
  09165 Substance dependence
   05031 Amphetamine addiction
    100995767 (PPP3R2)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    100995767 (PPP3R2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:pps01009]
    100995767 (PPP3R2)
Protein phosphatases and associated proteins [BR:pps01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     100995767 (PPP3R2)
SSDB
Motif
Pfam: EF-hand_1 EF-hand_7 EF-hand_5 EF-hand_6 EF-hand_8 SPARC_Ca_bdg EF-hand_4 EF-hand_9 YtfJ_HI0045
Other DBs
NCBI-GeneID: 100995767
NCBI-ProteinID: XP_003820702
Position
9
AA seq 173 aa
MSTMGNEASYPAEMCSHFDNDEIKRLGRRFKKLDLDKSGSLSVEEFMSLPELRHNPLVRR
VIDVFDTDGDGEVDFKEFILGTSQFSVKGNEEQKLRFAFSIYDMDKDGYISNGELFQVLK
MMVGNNLTDWQLQQLVDKTIIILDKDGDGKISFEEFSAVVRDLEIHKKLVLIV
NT seq 522 nt   +upstreamnt  +downstreamnt
atgtccacaatgggaaacgaggccagttacccggcggagatgtgctcccactttgacaat
gatgaaattaaaaggctgggcaggaggtttaagaagttggacttggacaaatcagggtct
ctgagcgtggaggagttcatgtccctgccggagctgcgccacaacccgttggtgcggcga
gtgatcgacgtcttcgacaccgacggtgatggagaagtggacttcaaggaattcatcctg
gggacctcccagttcagcgtcaagggcaacgaggagcagaagttgaggtttgcgttcagc
atttacgacatggataaagatggctacatttccaacggggagctcttccaggtgctgaag
atgatggtgggcaacaacctgacggactggcagctccagcagctggtcgacaaaaccatc
atcatcctggacaaggatggcgatgggaagatatcctttgaggaattcagtgctgtggtc
agagacctggagatccacaagaagctggtcctcatcgtgtga

DBGET integrated database retrieval system